Rv2699c Still unknown · low auto-curated

H37Rv Rv2699c · MTBC0 mtbc0_002873 · 100 aa · 3037078–3037380 (-) · RefSeq NP_217215.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF4193 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4193. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YA17 TrEMBL · unreviewed · Evidence at protein level
UniProt namedUTPase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4193)
Orthologous group2ATJW

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4193PF13834.12 1.4e-451–99 Domain of unknown function (DUF4193)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 784 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2050 rbpA RNA polymerase-binding protein RbpA 783 784 ctx cooccurence:773
Rv1830 HTH-type transcriptional regulator 772 772 ctx cooccurence:771
Rv1423 whiA transcriptional regulator WhiA 766 766 ctx cooccurence:766
Rv2239c hyp hypothetical protein 751 752 ctx cooccurence:751
Rv2256c hyp hypothetical protein 751 752 ctx cooccurence:750
Rv2700 cei hyp hypothetical protein 745 746 ctx neighborhood:746
Rv2731 hyp hypothetical protein 739 739 ctx cooccurence:738
Rv2708c hyp hypothetical protein 724 725 ctx cooccurence:722
Rv2206 transmembrane protein 722 723 ctx cooccurence:722
Rv2745c clgR transcriptional regulator ClgR 714 715 ctx cooccurence:711
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 711 712 ctx cooccurence:711
Rv2413c hyp hypothetical protein 706 706 ctx cooccurence:706
Rv3195 hyp hypothetical protein 701 701 ctx cooccurence:701
Rv2219 transmembrane protein 696 696 ctx cooccurence:693
Rv1440 secG protein-export membrane protein SecG 688 688 ctx cooccurence:687

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF4193 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF4193 PF13834.12 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217215.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4193 (PF13834.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ATJW
  • Curated reference: UniProt I6YA17 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor rbpA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002873|Rv2699c|
MPTDYDAPRRTETDDVSEDSLEELKARRNEAASAVVDVDESESAESFELPGADLSGEELSVRVVPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA