Rv2699c Still unknown · low auto-curated
H37Rv Rv2699c · MTBC0 mtbc0_002873 ·
100 aa · 3037078–3037380 (-) ·
RefSeq NP_217215.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4193 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF4193. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YA17
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | dUTPase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4193) |
| Orthologous group | 2ATJW |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4193 | PF13834.12 | 1.4e-45 | 1–99 | Domain of unknown function (DUF4193) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 784 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2050 rbpA |
RNA polymerase-binding protein RbpA | 783 | 784 ctx | cooccurence:773 |
Rv1830 |
HTH-type transcriptional regulator | 772 | 772 ctx | cooccurence:771 |
Rv1423 whiA |
transcriptional regulator WhiA | 766 | 766 ctx | cooccurence:766 |
Rv2239c hyp |
hypothetical protein | 751 | 752 ctx | cooccurence:751 |
Rv2256c hyp |
hypothetical protein | 751 | 752 ctx | cooccurence:750 |
Rv2700 cei hyp |
hypothetical protein | 745 | 746 ctx | neighborhood:746 |
Rv2731 hyp |
hypothetical protein | 739 | 739 ctx | cooccurence:738 |
Rv2708c hyp |
hypothetical protein | 724 | 725 ctx | cooccurence:722 |
Rv2206 |
transmembrane protein | 722 | 723 ctx | cooccurence:722 |
Rv2745c clgR |
transcriptional regulator ClgR | 714 | 715 ctx | cooccurence:711 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 711 | 712 ctx | cooccurence:711 |
Rv2413c hyp |
hypothetical protein | 706 | 706 ctx | cooccurence:706 |
Rv3195 hyp |
hypothetical protein | 701 | 701 ctx | cooccurence:701 |
Rv2219 |
transmembrane protein | 696 | 696 ctx | cooccurence:693 |
Rv1440 secG |
protein-export membrane protein SecG | 688 | 688 ctx | cooccurence:687 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF4193 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF4193 PF13834.12 (E=1e-45)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217215.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4193 (PF13834.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2ATJW - Curated reference: UniProt I6YA17 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
49 functional partner(s); context anchor
rbpA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002873|Rv2699c| MPTDYDAPRRTETDDVSEDSLEELKARRNEAASAVVDVDESESAESFELPGADLSGEELSVRVVPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA