clgR Family assigned · medium auto-curated
H37Rv Rv2745c · MTBC0 mtbc0_002922 ·
112 aa ·
3080608–3080946 MTBC0
(-) ·
RefSeq NP_217261.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional regulator ClgR |
|---|---|
| MTBC0 PGAP re-annotation | transcriptional regulator ClgR |
| Revised (this work) | Transcriptional regulator ClgR. Pfam: HTH_31 (PF13560.13), HTH_3 (PF01381.29), HTH_25 (PF13413.13). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 21 publications
21 TB publications mention this gene. 21 publication(s) discuss this gene (20 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Resilience to stress and antibiotics, coupled with immunomodulatory behavior, uncovers Mycobacterium indicus pranii as a suitable surrogate model for tuberculosis research. doi:10.1016/j.bbrc.2025.152296 | 2025 |
| Structure of the SigE regulatory network in Mycobacterium tuberculosis. doi:10.3389/fmicb.2024.1407500 | 2024 |
| SigE: A master regulator of Mycobacterium tuberculosis. doi:10.3389/fmicb.2023.1075143 | 2023 |
| Applications of Transcriptomics and Proteomics for Understanding Dormancy and Resuscitation in Mycobacterium tuberculosis. doi:10.3389/fmicb.2021.642487 | 2021 |
| Hypoxia Is Not a Main Stress When Mycobacterium tuberculosis Is in a Dormancy-Like Long-Chain Fatty Acid Environment. doi:10.3389/fcimb.2018.00449 | 2018 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Rv1776c+WhiB4 (Rv1776c and whiB4 ).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.20 (95% CI 0.04 to 0.39). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Transcriptional regulator |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2766c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_1970
· 76.8% identity |
| M. smegmatis |
MSMEG_2694
· 71.7% identity |
| M. orygis |
RJtmp_002832
· 100.0% identity |
| M. abscessus |
MAB_3068c
· 61.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMH7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transcriptional regulator ClgR |
| Curated function | Key stress-response regulator that plays an important role in multiple regulatory networks in response to different stress conditions. Involved in preservation of envelope integrity and tolerance to surface stress. Essential for macrophage infection and facilitates intracellular growth of M.tuberculosis. Controls the expression of several protease and chaperone systems, including clpP1, clpP2, clpC1, ptrB, Rv1043c, acr2, clpB, Rv3269 and the clgR-pspA-rv2743c-rv2742c region. Also plays an essential role in RecA/LexA-independent DNA repair mechanism by inducing expression of DNA repair genes in. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | clgR |
| eggNOG description | transcriptional |
| Orthologous group | COG1396 |
| Gene Ontology (125) |
GO:0002682, GO:0002683, GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006109, GO:0006355, GO:0006950, GO:0006979, GO:0008150, GO:0009266 +113 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (215) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 73.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 62.7% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 3 in the ORF — 0 in the essential state, 0 growth-defect, 3 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 253. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 5 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 2.06 ppm · rank 3165/3519 (10.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 112 aa |
|---|---|
| Molecular weight | 11.8 kDa |
| Theoretical pI | 9.75 |
| GRAVY | 0.202 (hydrophobic) |
| Aliphatic index | 111.5 |
| Aromaticity | 0.009 |
| Instability index | 46.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HTH_31 | PF13560.13 | 2.6e-09 | 10–63 | Helix-turn-helix domain |
HTH_3 | PF01381.29 | 1.2e-10 | 13–65 | Helix-turn-helix |
HTH_25 | PF13413.13 | 2.2e-05 | 13–45 | Helix-turn-helix domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5woq-assembly2_C |
1.00 | 0.98 | 1.9e-09 sig | 5woq-assembly2_C Crystal structure of an XRE family protein transcriptional regulator from Mycobacterium smegmatis |
3f52-assembly1_A |
1.00 | 0.95 | 5.9e-07 sig | 3f52-assembly1_A Crystal structure of the clp gene regulator ClgR from C. glutamicum |
3f51-assembly1_A |
1.00 | 0.86 | 2.4e-07 sig | 3f51-assembly1_A Crystal Structure of the clp gene regulator ClgR from Corynebacterium glutamicum |
3f52-assembly1_E |
1.00 | 0.96 | 2.3e-06 sig | 3f52-assembly1_E Crystal structure of the clp gene regulator ClgR from C. glutamicum |
2b5a-assembly1_A |
1.00 | 0.95 | 7.7e-05 sig | 2b5a-assembly1_A C.BclI, Control Element of the BclI Restriction-Modification System |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | 35kd_ag (- strand, 129 bp gap) |
|---|---|
| Downstream (3' on genome) | pgsA3 (- strand, 70 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor
| Regulon | this transcription factor regulates 4 target gene(s) |
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 716 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2744c 35kd_ag hyp |
hypothetical protein | 973 | 925 ctx | neighborhood:759 coexpression:703 textmining:665 |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 809 | 717 | coexpression:716 |
Rv2050 rbpA |
RNA polymerase-binding protein RbpA | 765 | 716 ctx | cooccurence:643 |
Rv2699c hyp |
hypothetical protein | 714 | 715 ctx | cooccurence:711 |
Rv2746c pgsA3 |
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | 658 | 658 ctx | neighborhood:656 |
Rv2743c hyp |
hypothetical protein | 950 | 635 ctx | neighborhood:616 textmining:870 |
Rv2708c hyp |
hypothetical protein | 634 | 635 ctx | cooccurence:627 |
Rv1830 |
HTH-type transcriptional regulator | 644 | 630 ctx | cooccurence:623 |
Rv2413c hyp |
hypothetical protein | 613 | 613 ctx | cooccurence:612 |
Rv2146c |
transmembrane protein | 599 | 599 ctx | cooccurence:595 |
Rv3195 hyp |
hypothetical protein | 592 | 592 ctx | cooccurence:592 |
Rv2256c hyp |
hypothetical protein | 586 | 586 ctx | cooccurence:569 |
Rv1423 whiA |
transcriptional regulator WhiA | 607 | 584 ctx | cooccurence:580 |
Rv2901c hyp |
hypothetical protein | 571 | 571 ctx | cooccurence:565 |
Rv3260c whiB2 |
transcriptional regulator WhiB2 | 568 | 568 ctx | cooccurence:562 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional regulator ClgR
- MTBC0 PGAP product: transcriptional regulator ClgR
- Pfam (hmmscan --cut_ga): HTH_31 PF13560.13 (E=3e-09), HTH_3 PF01381.29 (E=1e-10), HTH_25 PF13413.13 (E=2e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217261.1)
- Domains: Pfam-A via hmmscan --cut_ga — HTH_31 (PF13560.13), HTH_3 (PF01381.29), HTH_25 (PF13413.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1396 - Curated reference: UniProt P9WMH7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
48 functional partner(s); context anchor
rbpA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002922|Rv2745c|clgR MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for clgR? Email the maintainer — the message is pre-filled with this gene's details.