rbpA Family assigned · medium auto-curated

H37Rv Rv2050 · MTBC0 mtbc0_002183 · 111 aa · 2336434–2336769 (+) · RefSeq NP_216566.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)RNA polymerase-binding protein RbpA
MTBC0 PGAP re-annotationRNA polymerase-binding protein RbpA
Revised (this work)RNA polymerase-binding protein RbpA. Pfam: RbpA (PF13397.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHJ5 SwissProt · reviewed · Evidence at protein level
UniProt nameRNA polymerase-binding protein RbpA
Curated functionBinds to RNA polymerase (RNAP), stimulating and stabilizing the formation of stable RNAP promoter complexes up to 2-fold from principal sigma factor SigA-dependent but not alternative sigma factor SigF-dependent promoters. Increases the affinity of core RNAP for SigA, increasing the transcriptional activity of RNAP. Stimulates transcription driven by SigB more than that driven by SigA. Unlike the case in M.smegmatis or S.coelicolor, has no effect on rifampicin inhibition of transcription. Has no effect on E.coli RNAP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerbpA
eggNOG descriptionBinds to RNA polymerase (RNAP), stimulating transcription from principal, but not alternative sigma factor promoters
Orthologous group2CNY9
Gene Ontology (51) GO:0001000, GO:0001098, GO:0001108, GO:0003674, GO:0005488, GO:0005515, GO:0006355, GO:0008150, GO:0008270, GO:0009889, GO:0009891, GO:0009893 +39 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RbpAPF13397.13 3.7e-424–106 RNA polymerase-binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpoZ (DNA-directed RNA polymerase subunit omega), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 999 999 experimental:999
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 998 999 ctx cooccurence:729 experimental:995
Rv2703 sigA RNA polymerase sigma factor SigA 995 995 experimental:995
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 990 982 experimental:982 textmining:504
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 991 975 experimental:974 textmining:669
Rv2710 sigB RNA polymerase sigma factor SigB 974 964 experimental:961
Rv3197A whiB7 transcriptional regulator WhiB7 902 899 experimental:898
Rv3583c carD RNA polymerase-binding transcription factor CarD 992 897 experimental:895 textmining:930
Rv2095c pafC proteasome accessory factor C 928 897 experimental:870
Rv2096c pafB proteasome accessory factor B 892 820 experimental:780 textmining:430
Rv2699c hyp hypothetical protein 783 784 ctx cooccurence:773
Rv1830 HTH-type transcriptional regulator 776 776 ctx cooccurence:766
Rv2708c hyp hypothetical protein 769 769 ctx cooccurence:767
Rv2413c hyp hypothetical protein 769 769 ctx cooccurence:769
Rv2731 hyp hypothetical protein 752 753 ctx cooccurence:750

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: RNA polymerase-binding protein RbpA
  • MTBC0 PGAP product: RNA polymerase-binding protein RbpA
  • Pfam (hmmscan --cut_ga): RbpA PF13397.13 (E=4e-42)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216566.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RbpA (PF13397.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CNY9
  • Curated reference: UniProt P9WHJ5 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 73 functional partner(s); context anchor rpoZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002183|Rv2050|rbpA
MADRVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGTLIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERLELIRSRRRG