Rv2695 Resolved · medium auto-curated
H37Rv Rv2695 · MTBC0 mtbc0_002869 ·
235 aa · 3034331–3035038 (+) ·
RefSeq NP_217211.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta fold hydrolase |
| Revised (this work) | Alpha/beta fold hydrolase. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y1I1
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved hypothetical alanine rich protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | Aldo Keto reductase |
| Orthologous group | COG0667 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2693c (integral membrane protein), high confidence from genomic context alone (score 734 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2418c octT hyp |
hypothetical protein | 779 | 771 ctx | cooccurence:764 |
Rv3415c hyp |
hypothetical protein | 771 | 771 ctx | cooccurence:768 |
Rv2186c hyp |
hypothetical protein | 748 | 749 ctx | cooccurence:747 |
Rv2693c |
integral membrane protein | 734 | 734 ctx | neighborhood:694 |
Rv3031 |
1,4-alpha-glucan-branching protein | 705 | 706 ctx | cooccurence:704 |
Rv0419 lpqM |
lipoprotein peptidase LpqM | 687 | 688 ctx | cooccurence:687 |
Rv2694c hyp |
hypothetical protein | 618 | 618 ctx | neighborhood:616 |
Rv2091c |
membrane protein | 609 | 609 ctx | cooccurence:605 |
Rv3217c |
integral membrane protein | 604 | 604 ctx | cooccurence:604 |
Rv0556 |
transmembrane protein | 599 | 599 ctx | cooccurence:599 |
Rv2174 mptA |
alpha(1->6)-mannopyranosyltransferase A | 591 | 591 ctx | cooccurence:539 |
Rv0250c hyp |
hypothetical protein | 588 | 589 ctx | cooccurence:586 |
Rv3034c |
acetyltransferase | 584 | 584 ctx | cooccurence:578 |
Rv2468c hyp |
hypothetical protein | 579 | 579 ctx | cooccurence:577 |
Rv1411c lprG |
lipoprotein LprG | 570 | 570 ctx | cooccurence:570 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: alpha/beta fold hydrolase
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217211.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0667 - Curated reference: UniProt I6Y1I1 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
76 functional partner(s); context anchor
Rv2693c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002869|Rv2695| MAVDLDGVTTVLLPGTGSDNDYVRRAFSAPLRRAGAVLVTPVPHPGRLIDGYRAALDDAARDGPVVVGGVSLGAAVAAAWALEHPDRAVAVLAALPAWTGEPELAPAAQAARYTAARLRCDGLAATTTRMRASSPVWLAEELTRSWRVQWPELPDAMEEAAAYVAPSRAELARLVAPLAVAAAVDDPIHPLQVAADWVSVAPHAALRTVTLDEIGADAAALGSACLAALAEVSGA