Rv2694c Family assigned · low auto-curated
H37Rv Rv2694c · MTBC0 mtbc0_002868 ·
122 aa · 3033814–3034182 (-) ·
RefSeq NP_217210.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | OB-fold nucleic acid binding domain-containing protein |
| Revised (this work) | OB-fold nucleic acid binding domain-containing protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O07196
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K TranscriptionL Replication, recombination and repair
|
|---|---|
| eggNOG description | nucleic acid binding, OB-fold, tRNA helicase-type |
| Orthologous group | COG1200 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2693c (integral membrane protein), high confidence from genomic context alone (score 844 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2693c |
integral membrane protein | 844 | 844 ctx | neighborhood:839 |
Rv2690c |
integral membrane protein | 747 | 747 ctx | cooccurence:740 |
Rv2744c 35kd_ag hyp |
hypothetical protein | 747 | 737 | coexpression:732 |
Rv0563 htpX |
protease HtpX | 730 | 730 | coexpression:730 |
Rv2692 ceoC |
TRK system potassium uptake protein CeoC | 718 | 718 ctx | cooccurence:717 |
Rv2691 ceoB |
TRK system potassium uptake protein CeoB | 692 | 692 ctx | cooccurence:691 |
Rv2695 hyp |
hypothetical protein | 618 | 618 ctx | neighborhood:616 |
Rv1929c hyp |
hypothetical protein | 471 | 446 ctx | cooccurence:440 |
Rv2185c TB16.3 hyp |
hypothetical protein | 435 | 436 ctx | cooccurence:430 |
Rv3013 hyp |
hypothetical protein | 441 | 420 | |
Rv1407 fmu |
16S rRNA m5C967 methyltransferase | 440 | 419 | |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 447 | 418 | |
Rv2343c dnaG |
DNA primase | 482 | 416 | coexpression:416 |
Rv0854 hyp |
hypothetical protein | 402 | 403 ctx | cooccurence:401 |
Rv3646c topA |
DNA topoisomerase I | 568 | 295 | textmining:413 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: OB-fold nucleic acid binding domain-containing protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217210.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1200 - Curated reference: UniProt O07196 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
Rv2693c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002868|Rv2694c| MGAQGYLRRLTRRLTEDLEQRDVEELSDEVLNAGAQRAIDCQRGQEVTVVGTLRSVETNGKGCSGGVRAELFDGSDTVTLVWLGQRRIPGIDTGRTLRVRGRLGKLENGTKAIYNPHYEIQR