Rv2688c Family assigned · medium auto-curated

H37Rv Rv2688c · MTBC0 mtbc0_002862 · 301 aa · 3027160–3028065 (-) · RefSeq NP_217204.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antibiotic ABC transporter ATP-binding protein
MTBC0 PGAP re-annotationABC transporter ATP-binding protein
Revised (this work)ABC transporter ATP-binding protein. Pfam: ABC_tran (PF00005.34), AAA_21 (PF13304.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQL7 SwissProt · reviewed · Evidence at protein level
UniProt nameFluoroquinolones export ATP-binding protein Rv2688c
EC (curated) EC 7.6.2.-
Curated functionPart of the ABC transporter complex Rv2686c/Rv2687c/Rv2688c involved in fluoroquinolones export. Confers resistance to ciprofloxacin and, to a lesser extent, norfloxacin, moxifloxacin and sparfloxacin. Probably responsible for energy coupling to the transport system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionABC transporter
Orthologous groupCOG1131
KEGG orthology K16907
KEGG pathways map02010
KEGG modules M00224
Gene Ontology (14) GO:0003674, GO:0005215, GO:0006810, GO:0008150, GO:0015562, GO:0015893, GO:0022857, GO:0042221, GO:0042493, GO:0042891, GO:0050896, GO:0051179 +2 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.369 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 3.3e-2536–175 ABC transporter
AAA_21PF13304.13 4.0e-08147–208 AAA domain, putative AbiEii toxin, Type IV TA system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2686c (antibiotic ABC transporter permease), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2686c antibiotic ABC transporter permease 999 998 ctx neighborhood:781 cooccurence:765 coexpression:740 database:900 textmining:860
Rv2687c antibiotic ABC transporter permease 996 996 ctx neighborhood:781 cooccurence:765 database:900
Rv1272c drug ABC transporter ATP-binding protein 698 661 database:536
Rv1349 irtB iron ABC transporter ATP-binding protein/permease IrtB 673 658 database:536
Rv1348 irtA iron ABC transporter ATP-binding protein/permease IrtA 667 647 database:536
Rv0194 multidrug ABC transporter ATPase/permease 679 614 database:536
Rv1273c drug ABC transporter ATP-binding protein 630 614 database:536
Rv1978 hyp hypothetical protein 581 582 ctx cooccurence:578
Rv3488 hyp hypothetical protein 536 536
Rv1305 atpE ATP synthase subunit C 532 523
Rv1310 atpD ATP synthase subunit beta 487 459 experimental:457
Rv2689c hyp hypothetical protein 459 459 ctx neighborhood:454
Rv1308 atpA ATP synthase subunit alpha 475 457 experimental:456
Rv1311 atpC ATP synthase subunit epsilon 453 454 experimental:444
Rv2938 drrC daunorubicin ABC transporter permease DrrC 511 441 coexpression:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antibiotic ABC transporter ATP-binding protein
  • MTBC0 PGAP product: ABC transporter ATP-binding protein
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=3e-25), AAA_21 PF13304.13 (E=4e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217204.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), AAA_21 (PF13304.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1131
  • Curated reference: UniProt P9WQL7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor Rv2686c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002862|Rv2688c|
MTALNRAVASARVGTEVIRVRGLTFRYPKAAEPAVRGMEFTVGRGEIFGLLGPSGAGKSTTQKLLIGLLRDHGGQATVWDKEPAEWGPDYYERIGVSFELPNHYQKLTGYENLRFFASLYAGATADPMQLLAAVGLADDAHTLVGKYSKGMQMRLTFARSLINDPELLFLDEPTSGLDPVNARKIKDIIVDLKARGRTIFLTTHDMATADELCDRVAFVVDGRIVALDSPTELKIARSRRRVRVEYRGDGGGLETAEFGMDGLADDPAFHSVLRNHHVETIHSREASLDDVFVEVTGRQLT