Rv2256c Still unknown · low auto-curated

H37Rv Rv2256c · MTBC0 - · 177 aa · 2529341–2529874 (-) · RefSeq NP_216772.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3145. Function unknown. Foldseek best (non-significant) hit: 6bwo-assembly1_A LarC2, the C-terminal domain of a cyclometallase invo (prob 0.77, TM 0.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53530 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF3145 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3145)
Orthologous group299E4

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.115 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3145PF11343.14 3.8e-6821–174 Protein of unknown function (DUF3145)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 79.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
6bwo-assembly1_A 0.77 0.32 3.3e-03 sig 6bwo-assembly1_A LarC2, the C-terminal domain of a cyclometallase involved in the synthesis of the NPN cofactor of lactate racemase, apo form
2cz4-assembly1_C 0.60 0.62 5.7e-01 2cz4-assembly1_C Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8
7r2y-assembly1_A 0.60 0.60 3.9e-01 7r2y-assembly1_A Carbon regulatory PII-like protein SbtB from Synechocystis sp. 6803 in complex with ATP resulting from short ATP soak, conflicting T-loop and C-loop with partial occupancy
3ab2-assembly1_A 0.57 0.49 1.6e-01 3ab2-assembly1_A Crystal structure of aspartate kinase from Corynebacterium glutamicum in complex with threonine
3ab2-assembly3_L 0.51 0.46 1.2e-01 3ab2-assembly3_L Crystal structure of aspartate kinase from Corynebacterium glutamicum in complex with threonine
2cz4-assembly1_B 0.41 0.60 1.0e+00 2cz4-assembly1_B Crystal structure of a putative PII-like signaling protein (TTHA0516) from Thermus thermophilus HB8
3ab2-assembly2_E 0.41 0.41 1.0e-01 3ab2-assembly2_E Crystal structure of aspartate kinase from Corynebacterium glutamicum in complex with threonine
2nzc-assembly1_C 0.38 0.66 1.6e+00 2nzc-assembly1_C The structure of uncharacterized protein TM1266 from Thermotoga maritima.

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2146c (transmembrane protein), high confidence from genomic context alone (score 774 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2146c transmembrane protein 773 774 ctx cooccurence:763
Rv2257c hyp hypothetical protein 759 760 ctx neighborhood:759
Rv2699c hyp hypothetical protein 751 752 ctx cooccurence:750
Rv2680 hyp hypothetical protein 743 733 ctx cooccurence:728
Rv2413c hyp hypothetical protein 706 706 ctx cooccurence:705
Rv2033c hyp hypothetical protein 704 705 ctx cooccurence:702
Rv1830 HTH-type transcriptional regulator 693 694 ctx cooccurence:689
Rv2050 rbpA RNA polymerase-binding protein RbpA 692 693 ctx cooccurence:689
Rv3258c hyp hypothetical protein 698 687 ctx cooccurence:670
Rv0004 hyp hypothetical protein 686 686 ctx cooccurence:685
Rv1423 whiA transcriptional regulator WhiA 683 683 ctx cooccurence:681
Rv1087A Rv1087A, len: 106 aa (fragment). Conserved hypothetical protein, highly similar to C-terminus of near ORF O53434|YA86_MYCTU|Rv1086|MT1118|MT 683 683 ctx cooccurence:683
Rv3683 hyp hypothetical protein 680 681 ctx cooccurence:679
Rv2917 hyp hypothetical protein 654 654 ctx cooccurence:654
Rv2260 hyp hypothetical protein 645 645 ctx neighborhood:644

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF3145 PF11343.14 (E=4e-68)
  • Foldseek best: 6bwo-assembly1_A LarC2, the C-terminal domain of a cyclometallase involved in th (prob 0.77, E=3e-03, TM=0.32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216772.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3145 (PF11343.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 299E4
  • Curated reference: UniProt O53530 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 79.7, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor Rv2146c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2256c|
MEPKEQQMRASNQFADVTSGVVYIHASPAAVCPHVEWALSSTLQAKANLVWTPQPALPPQLRAVTNWVGPVGTGARLANALRSWSVLRFEVTEDPSPGVDGQRFSHTPQLGLWSGAMSANGDIMVGEMRLRAMMAQGADTLAAELDSVLGTAWDQALEVYRDGGDAGEVTWLSRGVG