Rv1830 Family assigned · medium auto-curated

H37Rv Rv1830 · MTBC0 - · 225 aa · 2074841–2075518 (+) · RefSeq NP_216346.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator
MTBC0 PGAP re-annotation
Revised (this work)HTH-type transcriptional regulator. Pfam: MerR_1 (PF13411.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WME5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized HTH-type transcriptional regulator Rv1830

UniProt still lists this protein as Uncharacterized HTH-type transcriptional regulator Rv1830; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namemerR2
eggNOG descriptiontranscriptional
Orthologous groupCOG0789

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.344 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MerR_1PF13411.13 1.9e-1269–135 MerR HTH family regulatory protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpoZ (DNA-directed RNA polymerase subunit omega), high confidence from genomic context alone (score 870 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 875 870 ctx cooccurence:757 experimental:463
Rv1440 secG protein-export membrane protein SecG 796 796 ctx cooccurence:771
Rv3260c whiB2 transcriptional regulator WhiB2 843 779 ctx cooccurence:770
Rv2050 rbpA RNA polymerase-binding protein RbpA 776 776 ctx cooccurence:766
Rv3219 whiB1 transcriptional regulator WhiB1 775 775 ctx cooccurence:772
Rv2699c hyp hypothetical protein 772 772 ctx cooccurence:771
Rv2219 transmembrane protein 750 751 ctx cooccurence:747
Rv1321 nucS endonuclease NucS 734 735 ctx cooccurence:731
Rv2901c hyp hypothetical protein 732 733 ctx cooccurence:730
Rv1423 whiA transcriptional regulator WhiA 754 719 ctx cooccurence:716
Rv3195 hyp hypothetical protein 717 718 ctx cooccurence:717
Rv3681c whiB4 transcriptional regulator WhiB4 719 708 ctx cooccurence:705
Rv2256c hyp hypothetical protein 693 694 ctx cooccurence:689
Rv2696c hyp hypothetical protein 689 690 ctx cooccurence:688
Rv2413c hyp hypothetical protein 684 685 ctx cooccurence:675

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): HTH-type transcriptional regulator
  • Pfam (hmmscan --cut_ga): MerR_1 PF13411.13 (E=2e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216346.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MerR_1 (PF13411.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0789
  • Curated reference: UniProt P9WME5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor rpoZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1830|
MTQLVTRARSARGSTLGEQPRQDQLDFADHTGTAGDGNDGAAAASGPVQPGLFPDDSVPDELVGYRGPSACQIAGITYRQLDYWARTSLVVPSIRSAAGSGSQRLYSFKDILVLKIVKRLLDTGISLHNIRVAVDHLRQRGVQDLANITLFSDGTTVYECTSAEEVVDLLQGGQGVFGIAVSGAMRELTGVIADFHGERADGGESIAAPEDELASRRKHRDRKIG