Rv2693c Still unknown · low auto-curated

H37Rv Rv2693c · MTBC0 mtbc0_002867 · 223 aa · 3033112–3033783 (-) · RefSeq NP_217209.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationDUF3159 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3159. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X548 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved integral membrane alanine and leucine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3159)
Orthologous group2AVV0

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.737 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3159PF11361.14 4.8e-6915–200 Protein of unknown function (DUF3159)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2772c (transmembrane protein), medium confidence from genomic context alone (score 511 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2694c hyp hypothetical protein 844 844 ctx neighborhood:839
Rv2695 hyp hypothetical protein 734 734 ctx neighborhood:694
Rv3195 hyp hypothetical protein 677 677 ctx cooccurence:676
Rv2696c hyp hypothetical protein 558 558 ctx cooccurence:445
Rv1486c hyp hypothetical protein 557 557 ctx cooccurence:553
Rv1286 cysC adenylyl-sulfate kinase 609 551
Rv3463 hyp hypothetical protein 533 512
Rv2772c transmembrane protein 511 511 ctx cooccurence:511
Rv1382 hyp hypothetical protein 497 498 ctx cooccurence:496
Rv0856 hyp hypothetical protein 483 483 ctx cooccurence:480
Rv0883c sepH hyp hypothetical protein 473 473
Rv0508 hyp hypothetical protein 490 471 ctx cooccurence:435
Rv0775 hyp hypothetical protein 463 464 ctx cooccurence:434
Rv2360c hyp hypothetical protein 463 463 ctx cooccurence:456
Rv0097 oxidoreductase 470 437 coexpression:405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: DUF3159 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF3159 PF11361.14 (E=5e-69)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217209.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3159 (PF11361.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AVV0
  • Curated reference: UniProt I6X548 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor Rv2772c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002867|Rv2693c|
MNANRTSAQRLLAQAGGVSGLVYSSLPVVTFVVASSAAGLLPAIGFALSMAGLILLWRLLRRESARPVVAGFCGVAVCALIAYLVGQSKGYFLLGIWMSLLWAVVFTLSILIRRPIVGYLWSWLSGRDRAWRDVSRAVFAFDVATLGWTLVFAARFIVQRHLYDADKTGWLGVARIGMGWPLTALAALATYAAIKAAQRAILASHDAAAVGGAAEFDADAGRE