Rv2693c Still unknown · low auto-curated
H37Rv Rv2693c · MTBC0 mtbc0_002867 ·
223 aa · 3033112–3033783 (-) ·
RefSeq NP_217209.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | integral membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF3159 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF3159. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6X548
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable conserved integral membrane alanine and leucine rich protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF3159) |
| Orthologous group | 2AVV0 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.737 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF3159 | PF11361.14 | 4.8e-69 | 15–200 | Protein of unknown function (DUF3159) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2772c (transmembrane protein), medium confidence from genomic context alone (score 511 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2694c hyp |
hypothetical protein | 844 | 844 ctx | neighborhood:839 |
Rv2695 hyp |
hypothetical protein | 734 | 734 ctx | neighborhood:694 |
Rv3195 hyp |
hypothetical protein | 677 | 677 ctx | cooccurence:676 |
Rv2696c hyp |
hypothetical protein | 558 | 558 ctx | cooccurence:445 |
Rv1486c hyp |
hypothetical protein | 557 | 557 ctx | cooccurence:553 |
Rv1286 cysC |
adenylyl-sulfate kinase | 609 | 551 | |
Rv3463 hyp |
hypothetical protein | 533 | 512 | |
Rv2772c |
transmembrane protein | 511 | 511 ctx | cooccurence:511 |
Rv1382 hyp |
hypothetical protein | 497 | 498 ctx | cooccurence:496 |
Rv0856 hyp |
hypothetical protein | 483 | 483 ctx | cooccurence:480 |
Rv0883c sepH hyp |
hypothetical protein | 473 | 473 | |
Rv0508 hyp |
hypothetical protein | 490 | 471 ctx | cooccurence:435 |
Rv0775 hyp |
hypothetical protein | 463 | 464 ctx | cooccurence:434 |
Rv2360c hyp |
hypothetical protein | 463 | 463 ctx | cooccurence:456 |
Rv0097 |
oxidoreductase | 470 | 437 | coexpression:405 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: integral membrane protein
- MTBC0 PGAP product: DUF3159 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF3159 PF11361.14 (E=5e-69)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217209.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF3159 (PF11361.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AVV0 - Curated reference: UniProt I6X548 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
Rv2772c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002867|Rv2693c| MNANRTSAQRLLAQAGGVSGLVYSSLPVVTFVVASSAAGLLPAIGFALSMAGLILLWRLLRRESARPVVAGFCGVAVCALIAYLVGQSKGYFLLGIWMSLLWAVVFTLSILIRRPIVGYLWSWLSGRDRAWRDVSRAVFAFDVATLGWTLVFAARFIVQRHLYDADKTGWLGVARIGMGWPLTALAALATYAAIKAAQRAILASHDAAAVGGAAEFDADAGRE