Rv2219 Still unknown · low auto-curated
H37Rv Rv2219 · MTBC0 mtbc0_002355 ·
250 aa · 2512392–2513144 (+) ·
RefSeq NP_216735.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4191 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF4191. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WLI1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2219 |
UniProt still lists this protein as Uncharacterized protein Rv2219; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4191) |
| Orthologous group | 2AUFS |
| Gene Ontology (14) |
GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0008150, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0040007, GO:0044425, GO:0044459 +2 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.372 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4191 | PF13829.12 | 1.4e-86 | 23–242 | Domain of unknown function (DUF4191) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: lipB (octanoyltransferase), high confidence from genomic context alone (score 847 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2217 lipB |
octanoyltransferase | 846 | 847 ctx | neighborhood:843 |
Rv2218 lipA |
lipoyl synthase | 846 | 847 ctx | neighborhood:843 |
Rv2216 |
epimerase family protein | 786 | 787 ctx | neighborhood:780 |
Rv2215 dlaT |
pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase | 782 | 783 ctx | neighborhood:780 |
Rv2708c hyp |
hypothetical protein | 755 | 755 ctx | cooccurence:753 |
Rv1830 |
HTH-type transcriptional regulator | 750 | 751 ctx | cooccurence:747 |
Rv2050 rbpA |
RNA polymerase-binding protein RbpA | 736 | 737 ctx | cooccurence:733 |
Rv2413c hyp |
hypothetical protein | 725 | 726 ctx | cooccurence:725 |
Rv2680 hyp |
hypothetical protein | 711 | 712 ctx | cooccurence:710 |
Rv3195 hyp |
hypothetical protein | 709 | 709 ctx | cooccurence:709 |
Rv1002c pmt |
dolichyl-phosphate-mannose--protein mannosyltransferase | 698 | 699 ctx | cooccurence:696 |
Rv2699c hyp |
hypothetical protein | 696 | 696 ctx | cooccurence:693 |
Rv2731 hyp |
hypothetical protein | 693 | 694 ctx | cooccurence:692 |
Rv1440 secG |
protein-export membrane protein SecG | 693 | 694 ctx | cooccurence:686 |
Rv3753c hyp |
hypothetical protein | 691 | 692 ctx | cooccurence:690 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: DUF4191 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF4191 PF13829.12 (E=1e-86)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216735.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4191 (PF13829.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AUFS - Curated reference: UniProt P9WLI1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
67 functional partner(s); context anchor
lipB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002355|Rv2219| MAKPRNAAESKAAKAQANAARKAAARQRRAQLWQAFTLQRKEDKRLLPYMIGAFLLIVGASVGVGVWAGGFTMFTMIPLGVLLGALVAFVIFGRRAQRTVYRKAEGQTGAAAWALDNLRGKWRVTPGVAATGNLDAVHRVIGRPGVIFVGEGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVPLAKLERHLTRLPANITVKQMDTVESRLAALGSRAGAGVMPKGPLPTTAKMRSVQRTVRRK