Rv2705c Family assigned · low auto-curated · to review
H37Rv Rv2705c · MTBC0 mtbc0_002879 ·
129 aa · 3042229–3042618 (-) ·
RefSeq NP_217221.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF952 domain-containing protein |
| Revised (this work) | DUF952 domain-containing protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).
Curated reference (UniProt)
| UniProt |
O07206
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Glutathione S-transferase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF952) |
| Orthologous group | COG3502 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF952 | PF06108.19 | 3.8e-28 | 14–102 | Protein of unknown function (DUF952) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 82.0 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
2o0q-assembly1_A |
1.00 | 0.84 | 1.2e-08 sig | 2o0q-assembly1_A X-ray Crystal Structure of Protein CC0527 from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55 |
2o0p-assembly1_A |
1.00 | 0.84 | 1.4e-08 sig | 2o0p-assembly1_A X-ray Crystal Structure of Protein CC0527 (V27M / L66M double mutant) from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55. |
2jqn-assembly1_A |
1.00 | 0.80 | 6.4e-07 sig | 2jqn-assembly1_A Solution NMR structure of CC0527 from Caulobacter crescentus. Northeast Structural Genomics Target CCR55 |
2hw2-assembly1_A |
0.16 | 0.50 | 2.6e+00 | 2hw2-assembly1_A Crystal structure of Rifampin ADP-ribosyl transferase in complex with Rifampin |
5lnx-assembly2_F |
0.05 | 0.26 | 1.4e+00 | 5lnx-assembly2_F Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis. |
1ukw-assembly1_A |
0.05 | 0.39 | 3.5e+00 | 1ukw-assembly1_A Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8 |
5lnx-assembly1_A |
0.02 | 0.26 | 3.9e+00 | 5lnx-assembly1_A Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis. |
5lnx-assembly1_D |
0.02 | 0.27 | 5.0e+00 | 5lnx-assembly1_D Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis. |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2707 hyp |
hypothetical protein | 781 | 781 ctx | neighborhood:778 |
Rv2706c hyp |
hypothetical protein | 969 | 774 ctx | neighborhood:773 textmining:870 |
Rv2036 hyp |
hypothetical protein | 490 | 50 | textmining:486 |
Rv3916c hyp |
hypothetical protein | 870 | 47 | textmining:870 |
Rv2704 hyp |
hypothetical protein | 870 | 47 | textmining:870 |
Rv3192 hyp |
hypothetical protein | 629 | 47 | textmining:627 |
Rv3256c hyp |
hypothetical protein | 870 | 44 | textmining:870 |
Rv0052 hyp |
hypothetical protein | 517 | 44 | textmining:516 |
Rv1775 hyp |
hypothetical protein | 438 | 43 | textmining:437 |
Rv3630 |
integral membrane protein | 431 | 41 | textmining:431 |
Rv0024 |
NLP/P60 family protein | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF952 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF952 PF06108.19 (E=4e-28)
- Foldseek best: 2o0q-assembly1_A X-ray Crystal Structure of Protein CC0527 from Caulobacter cres (prob 1.00, E=1e-08, TM=0.84)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217221.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF952 (PF06108.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3502 - Curated reference: UniProt O07206 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 82.0, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002879|Rv2705c| MRMTPDPAMLVHLCGVQEWSHARERGGIYPESDKTGYIHLSTLEQVHLPANRLYRGRADLVLLYIDPAALDSPVRWEPGVPTDPRSMLFPHLYGPLPVRAVIGAAAYPPAGDGSFGPAPEFRSATADPT