Rv2705c Family assigned · low auto-curated · to review

H37Rv Rv2705c · MTBC0 mtbc0_002879 · 129 aa · 3042229–3042618 (-) · RefSeq NP_217221.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF952 domain-containing protein
Revised (this work)DUF952 domain-containing protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt O07206 TrEMBL · unreviewed · Evidence at protein level
UniProt nameGlutathione S-transferase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF952)
Orthologous groupCOG3502

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF952PF06108.19 3.8e-2814–102 Protein of unknown function (DUF952)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 82.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2o0q-assembly1_A 1.00 0.84 1.2e-08 sig 2o0q-assembly1_A X-ray Crystal Structure of Protein CC0527 from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55
2o0p-assembly1_A 1.00 0.84 1.4e-08 sig 2o0p-assembly1_A X-ray Crystal Structure of Protein CC0527 (V27M / L66M double mutant) from Caulobacter crescentus. Northeast Structural Genomics Consortium Target CcR55.
2jqn-assembly1_A 1.00 0.80 6.4e-07 sig 2jqn-assembly1_A Solution NMR structure of CC0527 from Caulobacter crescentus. Northeast Structural Genomics Target CCR55
2hw2-assembly1_A 0.16 0.50 2.6e+00 2hw2-assembly1_A Crystal structure of Rifampin ADP-ribosyl transferase in complex with Rifampin
5lnx-assembly2_F 0.05 0.26 1.4e+00 5lnx-assembly2_F Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis.
1ukw-assembly1_A 0.05 0.39 3.5e+00 1ukw-assembly1_A Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8
5lnx-assembly1_A 0.02 0.26 3.9e+00 5lnx-assembly1_A Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis.
5lnx-assembly1_D 0.02 0.27 5.0e+00 5lnx-assembly1_D Crystal structure of MmgC, an acyl-CoA dehydrogenase from bacillus subtilis.

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2707 hyp hypothetical protein 781 781 ctx neighborhood:778
Rv2706c hyp hypothetical protein 969 774 ctx neighborhood:773 textmining:870
Rv2036 hyp hypothetical protein 490 50 textmining:486
Rv3916c hyp hypothetical protein 870 47 textmining:870
Rv2704 hyp hypothetical protein 870 47 textmining:870
Rv3192 hyp hypothetical protein 629 47 textmining:627
Rv3256c hyp hypothetical protein 870 44 textmining:870
Rv0052 hyp hypothetical protein 517 44 textmining:516
Rv1775 hyp hypothetical protein 438 43 textmining:437
Rv3630 integral membrane protein 431 41 textmining:431
Rv0024 NLP/P60 family protein 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF952 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF952 PF06108.19 (E=4e-28)
  • Foldseek best: 2o0q-assembly1_A X-ray Crystal Structure of Protein CC0527 from Caulobacter cres (prob 1.00, E=1e-08, TM=0.84)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217221.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF952 (PF06108.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3502
  • Curated reference: UniProt O07206 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 82.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002879|Rv2705c|
MRMTPDPAMLVHLCGVQEWSHARERGGIYPESDKTGYIHLSTLEQVHLPANRLYRGRADLVLLYIDPAALDSPVRWEPGVPTDPRSMLFPHLYGPLPVRAVIGAAAYPPAGDGSFGPAPEFRSATADPT