Rv3195 Resolved · high auto-curated

H37Rv Rv3195 · MTBC0 mtbc0_003396 · 472 aa · 3586496–3587914 (+) · RefSeq NP_217711.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationzinc-dependent metalloprotease
Revised (this work)Zinc-dependent metalloprotease. Pfam: Zincin_2 (PF10103.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53341 TrEMBL · unreviewed · Predicted
UniProt nameHydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionhydrolase
Orthologous groupCOG5282

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.633 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 9 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.45% of strains (654) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Zincin_2PF10103.16 1.2e-12585–433 Zincin-like metallopeptidase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1830 (HTH-type transcriptional regulator), high confidence from genomic context alone (score 718 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3194c hyp hypothetical protein 837 838 ctx neighborhood:784
Rv3196 hyp hypothetical protein 803 803 ctx neighborhood:802
Rv2460c clpP2 ATP-dependent CLP protease proteolytic subunit 2 807 776 coexpression:776
Rv1998c hyp hypothetical protein 767 768 coexpression:768
Rv1830 HTH-type transcriptional regulator 717 718 ctx cooccurence:717
Rv2413c hyp hypothetical protein 717 717 ctx cooccurence:716
Rv2219 transmembrane protein 709 709 ctx cooccurence:709
Rv2699c hyp hypothetical protein 701 701 ctx cooccurence:701
Rv3219 whiB1 transcriptional regulator WhiB1 701 701 ctx cooccurence:701
Rv2050 rbpA RNA polymerase-binding protein RbpA 687 687 ctx cooccurence:687
Rv1440 secG protein-export membrane protein SecG 683 683 ctx cooccurence:683
Rv2693c integral membrane protein 677 677 ctx cooccurence:676
Rv1321 nucS endonuclease NucS 658 659 ctx cooccurence:657
Rv2708c hyp hypothetical protein 655 655 ctx cooccurence:655
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 644 644 ctx cooccurence:638

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: zinc-dependent metalloprotease
  • Pfam (hmmscan --cut_ga): Zincin_2 PF10103.16 (E=1e-125)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217711.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Zincin_2 (PF10103.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5282
  • Curated reference: UniProt O53341 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 50 functional partner(s); context anchor Rv1830
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003396|Rv3195|
MSTGEVMGDLPFGFSSGDDPPEDPSGRDKRGKDGADSGSGANPLGAFGIGGEFNMADLGQIFTRLGEMFGGVGTAMAAGKTSGPVNYDLARQVASSSIGFIAPIPAATNSAIADAVHLADTWLDGATSLPAGATKAVGWSPTDWVDNTLATWKRLCDPMAQQISTVWASSLPEEAKSMAGPLLSIMSQMGGIAFGSQLGQALGRLSREVLTSTDIGLPLGPKGVAAILPGAVESFAAGLEQPRSEILTFLATREAAHHRLFSHVPWLASQLLGAVEAYAMGMKIDMTGIEELARDINPTSLADPAAMEQLLSQGVFEPKATPAQTQALERLETLLALIEGWVQTVVTAALGERIPGEAALSETLRRRRASGGPAEQTFATLVGLELRPRKLREAGALWERLTRAVGMDARDAVWQHPDLLPATDDLDDPAAFIDRVIGGDTSGIDEAIAELERDQQARGADDSGHDGGPVDN