Rv2712c Still unknown · low auto-curated
H37Rv Rv2712c · MTBC0 mtbc0_002886 ·
352 aa · 3046685–3047743 (-) ·
RefSeq NP_217228.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4192 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF4192. Function unknown. Foldseek best (non-significant) hit: 7ya9-assembly1_A-2 Fis1 (Mitochondrial fission 1 protein) (prob 0.99, TM 0.57). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YE70
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | DUF4192 domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4192) |
| Orthologous group | 2AR9G |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.117 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.16% of strains (229) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4192 | PF13830.12 | 1.6e-93 | 13–321 | Domain of unknown function (DUF4192) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 93.5 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7ya9-assembly1_A-2 |
0.99 | 0.57 | 1.6e-01 | 7ya9-assembly1_A-2 Fis1 (Mitochondrial fission 1 protein) |
8xwx-assembly1_B |
0.97 | 0.58 | 3.3e-01 | 8xwx-assembly1_B Crystal structure of FIS1-BAP31 complex from human |
1nzn-assembly1_A |
0.97 | 0.59 | 3.6e-01 | 1nzn-assembly1_A Cytosolic domain of the human mitchondrial fission protein Fis1 adopts a TPR fold |
8u1z-assembly1_A |
0.93 | 0.58 | 5.7e-01 | 8u1z-assembly1_A Crystal structure of the Fis1 cytosolic domain bound to a peptide inhibitor |
4n3c-assembly1_A |
0.75 | 0.59 | 1.4e+00 | 4n3c-assembly1_A Crystal Structure of human O-GlcNAc Transferase bound to a peptide from HCF-1 pro-repeat2(1-26) and UDP-GlcNAc |
1pc2-assembly1_A |
0.72 | 0.42 | 3.1e-01 | 1pc2-assembly1_A Solution structure of human mitochondria fission protein Fis1 |
3asd-assembly1_A |
0.57 | 0.47 | 1.2e+00 | 3asd-assembly1_A MamA R50E mutant |
4cgw-assembly1_A |
0.54 | 0.52 | 1.6e+00 | 4cgw-assembly1_A Second TPR of Spaghetti (RPAP3) bound to HSP90 peptide SRMEEVD |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: sthA (pyridine nucleotide transhydrogenase), high confidence from genomic context alone (score 779 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2713 sthA |
pyridine nucleotide transhydrogenase | 779 | 779 ctx | neighborhood:778 |
Rv1486c hyp |
hypothetical protein | 712 | 712 ctx | cooccurence:712 |
Rv1109c hyp |
hypothetical protein | 685 | 685 ctx | cooccurence:685 |
Rv1222 rseA |
anti-sigma E factor RseA | 665 | 666 ctx | cooccurence:661 |
Rv0817c lmeA hyp |
hypothetical protein | 662 | 662 ctx | cooccurence:662 |
Rv3244c lpqB |
lipoprotein LpqB | 657 | 657 ctx | cooccurence:656 |
Rv3212 hyp |
hypothetical protein | 653 | 653 ctx | cooccurence:651 |
Rv2672 |
protease | 638 | 638 ctx | cooccurence:638 |
Rv2743c hyp |
hypothetical protein | 636 | 637 ctx | cooccurence:635 |
Rv2138 lppL |
lipoprotein LppL | 633 | 633 ctx | cooccurence:631 |
Rv0479c |
membrane protein | 620 | 621 ctx | cooccurence:620 |
Rv2862c hyp |
hypothetical protein | 617 | 618 ctx | cooccurence:617 |
Rv1166 lpqW |
monoacyl phosphatidylinositol tetramannoside-binding protein LpqW | 615 | 615 ctx | cooccurence:613 |
Rv2360c hyp |
hypothetical protein | 613 | 613 ctx | cooccurence:611 |
Rv1312 hyp |
hypothetical protein | 612 | 612 ctx | cooccurence:612 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF4192 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF4192 PF13830.12 (E=2e-93)
- Foldseek best: 7ya9-assembly1_A-2 Fis1 (Mitochondrial fission 1 protein) (prob 0.99, E=2e-01, TM=0.57)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217228.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4192 (PF13830.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AR9G - Curated reference: UniProt I6YE70 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 93.5, very high)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
105 functional partner(s); context anchor
sthA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002886|Rv2712c| MTKYRGQFELNRPATLIAALPAILGFVPEKSLVLVSLAAGELGSVMRADLCDELADRVGHLAELVAAANPAAAIAVIVDANGAQCPRCNEEYRQLCAALAAALSQRDIVLWAAHVVDRVAAGGRWHCVDGCGCSGVIDDPSASPLAMAAVLDGRQLYPRRSDLQAVIAVDDPVRSAELAVALGHQAADREIAHRADSVGCSRQDVENALAAAARVADGQSLSDTELARLGCALGDARVRDMLYALAVGENAGAAESLWALLARVLPEPWRVEALVLLAFSAYARGDGPLAGVSLQAALCCEPGHRMAGMLDTALQSGLRPEHIRDIAVTGYQRAEQLGIRLPPRRAFGQRAG