Rv2686c Family assigned · low auto-curated
H37Rv Rv2686c · MTBC0 mtbc0_002860 ·
252 aa · 3025695–3026453 (-) ·
RefSeq NP_217202.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antibiotic ABC transporter permease |
|---|---|
| MTBC0 PGAP re-annotation | fluoroquinolones efflux ABC transporter permease |
| Revised (this work) | Fluoroquinolones efflux ABC transporter permease. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJB3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Fluoroquinolones export permease protein Rv2686c |
| Curated function | Part of the ABC transporter complex Rv2686c/Rv2687c/Rv2688c involved in fluoroquinolones export. Confers resistance to ciprofloxacin and, to a lesser extent, norfloxacin, moxifloxacin and sparfloxacin. Probably responsible for the translocation of the substrate across the membrane. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2AG5J |
|---|---|
| KEGG orthology |
K16905
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00224
|
| Gene Ontology (9) |
GO:0003674, GO:0005215, GO:0006810, GO:0008150, GO:0015562, GO:0022857, GO:0051179, GO:0051234, GO:0055085
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.188 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.39% of strains (566) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2687c (antibiotic ABC transporter permease), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2687c |
antibiotic ABC transporter permease | 999 | 999 ctx | neighborhood:882 cooccurence:774 coexpression:783 database:900 |
Rv2688c |
antibiotic ABC transporter ATP-binding protein | 999 | 998 ctx | neighborhood:781 cooccurence:765 coexpression:740 database:900 textmining:860 |
Rv1978 hyp |
hypothetical protein | 772 | 772 ctx | cooccurence:771 |
Rv0210 hyp |
hypothetical protein | 734 | 735 ctx | cooccurence:734 |
Rv3912 rsmA |
anti-sigma-M factor RsmA | 727 | 728 ctx | cooccurence:727 |
Rv0955 |
integral membrane protein | 685 | 686 ctx | cooccurence:685 |
Rv0097 |
oxidoreductase | 670 | 670 ctx | cooccurence:670 |
Rv1181 pks4 |
polyketide beta-ketoacyl synthase | 635 | 635 ctx | cooccurence:634 |
Rv1182 papA3 |
acyltransferase papA3 | 633 | 633 ctx | cooccurence:632 |
Rv3405c |
HTH-type transcriptional regulator | 622 | 622 ctx | cooccurence:617 |
Rv0849 |
MFS-type transporter | 620 | 620 ctx | cooccurence:618 |
Rv3824c papA1 |
acyltransferase | 596 | 596 ctx | cooccurence:596 |
Rv0804 hyp |
hypothetical protein | 592 | 592 ctx | cooccurence:592 |
Rv2378c mbtG |
L-lysine N6-monooxygenase | 586 | 586 ctx | cooccurence:584 |
Rv2633c hyp |
hypothetical protein | 578 | 578 ctx | cooccurence:578 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antibiotic ABC transporter permease
- MTBC0 PGAP product: fluoroquinolones efflux ABC transporter permease
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217202.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2AG5J - Curated reference: UniProt P9WJB3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
Rv2687c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002860|Rv2686c| MRAISSLAGPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPLFTEMLARRYGFDLVGYYPLILTAFLLLTSIIVAGALAAFLVLDDVDAGTMTALRVTPVPLSVFFGYRAATVMVVTTIYVVATMSCSGILEPGLVSSLIPIGLVAGLSAVVTLLLILAVANNKIQGLAMVRALGMLIAGLPCLPWFISSNWNLAFGVLPPYWAAKAFWVASDHGTWWPYLVGGAVYNLAIVWVLFRRFRAKHA