Rv2686c Family assigned · low auto-curated

H37Rv Rv2686c · MTBC0 mtbc0_002860 · 252 aa · 3025695–3026453 (-) · RefSeq NP_217202.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antibiotic ABC transporter permease
MTBC0 PGAP re-annotationfluoroquinolones efflux ABC transporter permease
Revised (this work)Fluoroquinolones efflux ABC transporter permease.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJB3 SwissProt · reviewed · Evidence at protein level
UniProt nameFluoroquinolones export permease protein Rv2686c
Curated functionPart of the ABC transporter complex Rv2686c/Rv2687c/Rv2688c involved in fluoroquinolones export. Confers resistance to ciprofloxacin and, to a lesser extent, norfloxacin, moxifloxacin and sparfloxacin. Probably responsible for the translocation of the substrate across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AG5J
KEGG orthology K16905
KEGG pathways map02010
KEGG modules M00224
Gene Ontology (9) GO:0003674, GO:0005215, GO:0006810, GO:0008150, GO:0015562, GO:0022857, GO:0051179, GO:0051234, GO:0055085

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.188 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 3 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.39% of strains (566) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2687c (antibiotic ABC transporter permease), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2687c antibiotic ABC transporter permease 999 999 ctx neighborhood:882 cooccurence:774 coexpression:783 database:900
Rv2688c antibiotic ABC transporter ATP-binding protein 999 998 ctx neighborhood:781 cooccurence:765 coexpression:740 database:900 textmining:860
Rv1978 hyp hypothetical protein 772 772 ctx cooccurence:771
Rv0210 hyp hypothetical protein 734 735 ctx cooccurence:734
Rv3912 rsmA anti-sigma-M factor RsmA 727 728 ctx cooccurence:727
Rv0955 integral membrane protein 685 686 ctx cooccurence:685
Rv0097 oxidoreductase 670 670 ctx cooccurence:670
Rv1181 pks4 polyketide beta-ketoacyl synthase 635 635 ctx cooccurence:634
Rv1182 papA3 acyltransferase papA3 633 633 ctx cooccurence:632
Rv3405c HTH-type transcriptional regulator 622 622 ctx cooccurence:617
Rv0849 MFS-type transporter 620 620 ctx cooccurence:618
Rv3824c papA1 acyltransferase 596 596 ctx cooccurence:596
Rv0804 hyp hypothetical protein 592 592 ctx cooccurence:592
Rv2378c mbtG L-lysine N6-monooxygenase 586 586 ctx cooccurence:584
Rv2633c hyp hypothetical protein 578 578 ctx cooccurence:578

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antibiotic ABC transporter permease
  • MTBC0 PGAP product: fluoroquinolones efflux ABC transporter permease
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217202.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AG5J
  • Curated reference: UniProt P9WJB3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor Rv2687c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002860|Rv2686c|
MRAISSLAGPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPLFTEMLARRYGFDLVGYYPLILTAFLLLTSIIVAGALAAFLVLDDVDAGTMTALRVTPVPLSVFFGYRAATVMVVTTIYVVATMSCSGILEPGLVSSLIPIGLVAGLSAVVTLLLILAVANNKIQGLAMVRALGMLIAGLPCLPWFISSNWNLAFGVLPPYWAAKAFWVASDHGTWWPYLVGGAVYNLAIVWVLFRRFRAKHA