Rv2698 Still unknown · low auto-curated
H37Rv Rv2698 · MTBC0 mtbc0_002872 ·
161 aa · 3036588–3037073 (+) ·
RefSeq NP_217214.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF3093 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF3093. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6X552
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved alanine rich transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF3093) |
| Orthologous group | 2E4C2 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.754 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF3093 | PF11292.15 | 1.4e-53 | 12–159 | Protein of unknown function (DUF3093) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dut (deoxyuridine 5'-triphosphate nucleotidohydrolase), high confidence from genomic context alone (score 793 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2696c hyp |
hypothetical protein | 800 | 800 ctx | neighborhood:727 |
Rv2697c dut |
deoxyuridine 5'-triphosphate nucleotidohydrolase | 793 | 793 ctx | neighborhood:790 |
Rv2235 |
transmembrane protein | 598 | 599 ctx | cooccurence:595 |
Rv3450c eccB4 |
ESX-4 secretion system protein EccB4 | 560 | 560 ctx | cooccurence:560 |
Rv3448 eccD4 |
ESX-4 secretion system protein EccD4 | 559 | 559 ctx | cooccurence:559 |
Rv0948c |
chorismate mutase | 538 | 539 ctx | cooccurence:536 |
Rv1782 eccB5 |
ESX-5 type VII secretion system protein EccB5 | 525 | 525 ctx | cooccurence:523 |
Rv3208A TB9.4 hyp |
hypothetical protein | 511 | 511 ctx | cooccurence:504 |
Rv2195 qcrA |
ubiquinol-cytochrome C reductase rieske iron-sulfur subunit | 501 | 501 ctx | cooccurence:498 |
Rv1796 mycP5 |
membrane-anchored mycosin MycP | 499 | 499 ctx | cooccurence:499 |
Rv2975c hyp |
hypothetical protein | 497 | 498 ctx | cooccurence:495 |
Rv1474c |
transcriptional regulator | 483 | 483 ctx | cooccurence:483 |
Rv3895c eccB2 |
ESX-2 secretion system protein EccB | 477 | 477 ctx | cooccurence:477 |
Rv1382 hyp |
hypothetical protein | 473 | 474 ctx | cooccurence:467 |
Rv1312 hyp |
hypothetical protein | 470 | 470 ctx | cooccurence:470 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: DUF3093 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF3093 PF11292.15 (E=1e-53)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217214.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF3093 (PF11292.15)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2E4C2 - Curated reference: UniProt I6X552 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
dut - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002872|Rv2698| MSGTRLAPHSVRYRERLWVPWWWWPLAFALAALIAFEVNLGVAALPDWVPFATLFTVAAGTLLWLGRVEIRVTAGSADGAGVKLWAGPAHLPVAVIARSAEIPATAKSAALGRQLDPAAYVLHRAWVGPMVLVVLDDPNDPTPYWLVSCRHPERVLSALRS