Rv2698 Still unknown · low auto-curated

H37Rv Rv2698 · MTBC0 mtbc0_002872 · 161 aa · 3036588–3037073 (+) · RefSeq NP_217214.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF3093 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3093. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X552 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved alanine rich transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3093)
Orthologous group2E4C2

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.754 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3093PF11292.15 1.4e-5312–159 Protein of unknown function (DUF3093)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dut (deoxyuridine 5'-triphosphate nucleotidohydrolase), high confidence from genomic context alone (score 793 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2696c hyp hypothetical protein 800 800 ctx neighborhood:727
Rv2697c dut deoxyuridine 5'-triphosphate nucleotidohydrolase 793 793 ctx neighborhood:790
Rv2235 transmembrane protein 598 599 ctx cooccurence:595
Rv3450c eccB4 ESX-4 secretion system protein EccB4 560 560 ctx cooccurence:560
Rv3448 eccD4 ESX-4 secretion system protein EccD4 559 559 ctx cooccurence:559
Rv0948c chorismate mutase 538 539 ctx cooccurence:536
Rv1782 eccB5 ESX-5 type VII secretion system protein EccB5 525 525 ctx cooccurence:523
Rv3208A TB9.4 hyp hypothetical protein 511 511 ctx cooccurence:504
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 501 501 ctx cooccurence:498
Rv1796 mycP5 membrane-anchored mycosin MycP 499 499 ctx cooccurence:499
Rv2975c hyp hypothetical protein 497 498 ctx cooccurence:495
Rv1474c transcriptional regulator 483 483 ctx cooccurence:483
Rv3895c eccB2 ESX-2 secretion system protein EccB 477 477 ctx cooccurence:477
Rv1382 hyp hypothetical protein 473 474 ctx cooccurence:467
Rv1312 hyp hypothetical protein 470 470 ctx cooccurence:470

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: DUF3093 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF3093 PF11292.15 (E=1e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217214.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3093 (PF11292.15)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E4C2
  • Curated reference: UniProt I6X552 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor dut
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002872|Rv2698|
MSGTRLAPHSVRYRERLWVPWWWWPLAFALAALIAFEVNLGVAALPDWVPFATLFTVAAGTLLWLGRVEIRVTAGSADGAGVKLWAGPAHLPVAVIARSAEIPATAKSAALGRQLDPAAYVLHRAWVGPMVLVVLDDPNDPTPYWLVSCRHPERVLSALRS