secG Family assigned · medium auto-curated
H37Rv Rv1440 · MTBC0 mtbc0_001541 ·
77 aa · 1627202–1627435 (+) ·
RefSeq NP_215956.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | protein-export membrane protein SecG |
|---|---|
| MTBC0 PGAP re-annotation | preprotein translocase subunit SecG |
| Revised (this work) | Preprotein translocase subunit SecG. Pfam: SecG (PF03840.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WGN5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable protein-export membrane protein SecG |
| Curated function | Involved in protein export. Participates in an early event of protein translocation (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
U Intracellular trafficking, secretion and vesicular transport
|
|---|---|
| Preferred name | secG |
| eggNOG description | translocase subunit secG |
| Orthologous group | COG1314 |
| KEGG orthology |
K03075
|
| KEGG pathways |
map02024, map03060, map03070
|
| KEGG modules |
M00335
|
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SecG | PF03840.20 | 2.0e-14 | 5–72 | Preprotein translocase SecG subunit |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rpoZ (DNA-directed RNA polymerase subunit omega), high confidence from genomic context alone (score 814 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0638 secE1 |
preprotein translocase SecE | 999 | 998 | coexpression:668 experimental:928 database:900 textmining:965 |
Rv0732 secY |
preprotein translocase SecY | 999 | 994 | experimental:928 database:900 textmining:947 |
Rv3921c yidC |
membrane protein insertase YidC | 985 | 980 | experimental:792 database:900 |
Rv3240c secA1 |
protein translocase subunit SecA | 996 | 978 | experimental:785 database:900 textmining:855 |
Rv1821 secA2 |
accessory Sec system translocase SecA2 | 995 | 978 | experimental:785 database:900 textmining:819 |
Rv2921c ftsY |
signal recognition particle receptor FtsY | 979 | 948 | experimental:474 database:900 textmining:623 |
Rv2916c ffh |
signal recognition particle protein | 959 | 943 | experimental:446 database:900 |
Rv2588c yajC |
membrane protein secretion factor YajC | 979 | 922 | database:900 textmining:745 |
Rv3443c rplM |
50S ribosomal protein L13 | 890 | 887 | coexpression:777 experimental:474 |
Rv2442c rplU |
50S ribosomal protein L21 | 874 | 868 | coexpression:741 experimental:474 |
Rv0979A rpmF |
50S ribosomal protein L32 | 859 | 860 | coexpression:725 experimental:474 |
Rv2587c secD |
protein translocase subunit SecD | 979 | 848 | experimental:836 textmining:872 |
Rv1015c rplY |
50S ribosomal protein L25/general stress protein Ctc | 847 | 847 | coexpression:712 experimental:474 |
Rv2904c rplS |
50S ribosomal protein L19 | 828 | 823 | coexpression:658 experimental:474 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 820 | 814 ctx | cooccurence:750 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: protein-export membrane protein SecG
- MTBC0 PGAP product: preprotein translocase subunit SecG
- Pfam (hmmscan --cut_ga): SecG PF03840.20 (E=2e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215956.2)
- Domains: Pfam-A via hmmscan --cut_ga — SecG (PF03840.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1314 - Curated reference: UniProt P9WGN5 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
122 functional partner(s); context anchor
rpoZ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001541|Rv1440|secG MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVTGIWLVSIIGVALLIKYR