secG Family assigned · medium auto-curated

H37Rv Rv1440 · MTBC0 mtbc0_001541 · 77 aa · 1627202–1627435 (+) · RefSeq NP_215956.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)protein-export membrane protein SecG
MTBC0 PGAP re-annotationpreprotein translocase subunit SecG
Revised (this work)Preprotein translocase subunit SecG. Pfam: SecG (PF03840.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGN5 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable protein-export membrane protein SecG
Curated functionInvolved in protein export. Participates in an early event of protein translocation (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
Preferred namesecG
eggNOG descriptiontranslocase subunit secG
Orthologous groupCOG1314
KEGG orthology K03075
KEGG pathways map02024, map03060, map03070
KEGG modules M00335
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SecGPF03840.20 2.0e-145–72 Preprotein translocase SecG subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpoZ (DNA-directed RNA polymerase subunit omega), high confidence from genomic context alone (score 814 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0638 secE1 preprotein translocase SecE 999 998 coexpression:668 experimental:928 database:900 textmining:965
Rv0732 secY preprotein translocase SecY 999 994 experimental:928 database:900 textmining:947
Rv3921c yidC membrane protein insertase YidC 985 980 experimental:792 database:900
Rv3240c secA1 protein translocase subunit SecA 996 978 experimental:785 database:900 textmining:855
Rv1821 secA2 accessory Sec system translocase SecA2 995 978 experimental:785 database:900 textmining:819
Rv2921c ftsY signal recognition particle receptor FtsY 979 948 experimental:474 database:900 textmining:623
Rv2916c ffh signal recognition particle protein 959 943 experimental:446 database:900
Rv2588c yajC membrane protein secretion factor YajC 979 922 database:900 textmining:745
Rv3443c rplM 50S ribosomal protein L13 890 887 coexpression:777 experimental:474
Rv2442c rplU 50S ribosomal protein L21 874 868 coexpression:741 experimental:474
Rv0979A rpmF 50S ribosomal protein L32 859 860 coexpression:725 experimental:474
Rv2587c secD protein translocase subunit SecD 979 848 experimental:836 textmining:872
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 847 847 coexpression:712 experimental:474
Rv2904c rplS 50S ribosomal protein L19 828 823 coexpression:658 experimental:474
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 820 814 ctx cooccurence:750

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: protein-export membrane protein SecG
  • MTBC0 PGAP product: preprotein translocase subunit SecG
  • Pfam (hmmscan --cut_ga): SecG PF03840.20 (E=2e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215956.2)
  • Domains: Pfam-A via hmmscan --cut_ga — SecG (PF03840.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1314
  • Curated reference: UniProt P9WGN5 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 122 functional partner(s); context anchor rpoZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001541|Rv1440|secG
MELALQITLIVTSVLVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEKNLDRLTLFVTGIWLVSIIGVALLIKYR