Rv2708c Still unknown · low auto-curated

H37Rv Rv2708c · MTBC0 - · 82 aa · 3021548–3021796 (-) · RefSeq NP_217224.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3039. Function unknown. Foldseek best (non-significant) hit: 1v6t-assembly1_A Crystal Structure of Lactam Utilization Protein from (prob 0.07, TM 0.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X562 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF3039 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3039)
Orthologous group2CAFG

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3039PF11238.14 2.1e-2824–79 Protein of unknown function (DUF3039)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 65.4 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1v6t-assembly1_A 0.07 0.34 1.1e+00 1v6t-assembly1_A Crystal Structure of Lactam Utilization Protein from Pyrococcus horikoshii Ot3
1uys-assembly1_A 0.04 0.19 7.2e-01 1uys-assembly1_A Acetyl-CoA carboxylase carboxyltransferase domain in complex with inhibitor haloxyfop
5csk-assembly1_A 0.02 0.15 6.8e-01 5csk-assembly1_A Crystal structure of yeast acetyl-CoA carboxylase, unbiotinylated
2w8m-assembly1_B 0.02 0.33 8.4e+00 2w8m-assembly1_B Structure of D212, a nuclease from a fusselovirus.
1uyr-assembly1_B 0.02 0.14 8.8e-01 1uyr-assembly1_B Acetyl-CoA Carboxylase Carboxyltransferase Domain in complex with inhibitor Diclofop
6e5u-assembly2_X 0.01 0.25 9.6e+00 6e5u-assembly2_X Crystal structure of the mRNA export receptor NXF1/NXT1 in complex with influenza virus NS1 protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2709 (transmembrane protein), high confidence from genomic context alone (score 820 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2709 transmembrane protein 820 820 ctx neighborhood:788
Rv2050 rbpA RNA polymerase-binding protein RbpA 769 769 ctx cooccurence:767
Rv2413c hyp hypothetical protein 760 761 ctx cooccurence:759
Rv2219 transmembrane protein 755 755 ctx cooccurence:753
Rv2699c hyp hypothetical protein 724 725 ctx cooccurence:722
Rv2731 hyp hypothetical protein 687 688 ctx cooccurence:686
Rv2696c hyp hypothetical protein 686 686 ctx cooccurence:685
Rv0807 hyp hypothetical protein 684 685 ctx cooccurence:682
Rv1830 HTH-type transcriptional regulator 671 671 ctx cooccurence:668
Rv2680 hyp hypothetical protein 670 671 ctx cooccurence:669
Rv2239c hyp hypothetical protein 661 661 ctx cooccurence:658
Rv3195 hyp hypothetical protein 655 655 ctx cooccurence:655
Rv2901c hyp hypothetical protein 635 635 ctx cooccurence:630
Rv2745c clgR transcriptional regulator ClgR 634 635 ctx cooccurence:627
Rv1002c pmt dolichyl-phosphate-mannose--protein mannosyltransferase 634 635 ctx cooccurence:633

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF3039 PF11238.14 (E=2e-28)
  • Foldseek best: 1v6t-assembly1_A Crystal Structure of Lactam Utilization Protein from Pyrococcus (prob 0.07, E=1e+00, TM=0.34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217224.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3039 (PF11238.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CAFG
  • Curated reference: UniProt I6X562 (TrEMBL, unreviewed; Evidence at protein level)
  • Model confidence: ESMFold per-residue pLDDT (mean 65.4, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 48 functional partner(s); context anchor Rv2709
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2708c|
MSGMQTQTIERTDADERVDDGTGSDTPKYFHYVKKDKIAESAVMGSHVVALCGEVFPVTRAPKPGSPVCPDCKRIYDTLKKG