Rv2689c Resolved · high auto-curated

H37Rv Rv2689c · MTBC0 mtbc0_002863 · 405 aa · 3028260–3029477 (-) · RefSeq NP_217205.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationclass I SAM-dependent RNA methyltransferase
Revised (this work)Class I SAM-dependent RNA methyltransferase. Pfam: TRAM (PF01938.27), tRNA_U5-meth_tr (PF05958.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07191 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved alanine and valine and glycine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
eggNOG descriptionBelongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family
Orthologous groupCOG0144

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.916 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 10 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.53% of strains (767) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
TRAMPF01938.27 4.6e-0616–60 TRAM domain
tRNA_U5-meth_trPF05958.18 2.1e-07332–404 tRNA (Uracil-5-)-methyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2690c (integral membrane protein), high confidence from genomic context alone (score 749 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2690c integral membrane protein 760 749 ctx neighborhood:743
Rv2691 ceoB TRK system potassium uptake protein CeoB 686 686 ctx neighborhood:684
Rv2692 ceoC TRK system potassium uptake protein CeoC 686 685 ctx neighborhood:684
Rv2118c trmI tRNA (adenine(58)-N(1))-methyltransferase 705 662 coexpression:662
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 589 589 ctx cooccurence:419
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 569 570
Rv3579c rlmB 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB 584 547
Rv2681 hyp hypothetical protein 542 543 coexpression:405
Rv1003 rsmI rRNA small subunit methyltransferase I 592 536 ctx cooccurence:490
Rv2686c antibiotic ABC transporter permease 530 531 ctx neighborhood:518
Rv2687c antibiotic ABC transporter permease 523 524 ctx neighborhood:518
Rv1407 fmu 16S rRNA m5C967 methyltransferase 640 520 coexpression:422
Rv1644 tsnR 23S rRNA methyltransferase TsnR 529 487
Rv1988 erm(37) 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) 534 474 coexpression:400
Rv1630 rpsA 30S ribosomal protein S1 470 471 coexpression:454

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: class I SAM-dependent RNA methyltransferase
  • Pfam (hmmscan --cut_ga): TRAM PF01938.27 (E=5e-06), tRNA_U5-meth_tr PF05958.18 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217205.1)
  • Domains: Pfam-A via hmmscan --cut_ga — TRAM (PF01938.27), tRNA_U5-meth_tr (PF05958.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0144
  • Curated reference: UniProt O07191 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor Rv2690c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002863|Rv2689c|
MTRAGDDAVNLTLVTGAPANGGSCVAHHEGRVVFVRYALPGERVRARVTAQRGSYWHAEAFEVIDPSPDRIGSLCSIAGADGAGCCDLAFAAPEAARTLKAQVVANQLERLGRHSWQGEAQPLSDAGPTGWRIRVRLDVGADRRPGFHRYHSGELVTDLDCGQLPVGMLDGLVAADWPPEAQLYVALDDDGERHVVCSVRQGPRNRTRTVTNVVEGAYHAHQRVHRRSWRVPVTAFWQAHRDAAAVYSDLIADWAQPAPGMTAWDLYGGAGVFAAVLGEAVGESGRVLTVDTSRLASGAARAALVDLPQVEVVTGSVRRVLAVQPAGADLAVLDPPRSGAGREVVDLLAGAGVPRLIHIGCEAASFARDIGLYRGHGYAVEKIKVFDAFPLTHYVECVALLTRKV