rpoZ Family assigned · medium auto-curated
H37Rv Rv1390 · MTBC0 mtbc0_001491 ·
110 aa ·
1574437–1574769 MTBC0
(+) ·
RefSeq NP_215906.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | DNA-directed RNA polymerase subunit omega |
|---|---|
| MTBC0 PGAP re-annotation | DNA-directed RNA polymerase subunit omega |
| Revised (this work) | DNA-directed RNA polymerase subunit omega. Pfam: RNA_pol_Rpb6 (PF01192.28). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) studied as much outside M. tuberculosis
The biology of this gene is documented at least as much outside M. tuberculosis as within it — 7 paper(s) in a non-TB mycobacterial context (M. abscessus 1, M. smegmatis 7) versus 4 in a TB context. Mycobacterial genetics is largely done in M. smegmatis, so part of what is “known” about this gene is known by proxy.
- Beyond Inhibition: Sublethal Rifampicin-Induced Molecular Adaptations Confer Phenotypic Drug Tolerance in Mycobacteria. (2026)
- Gene expression during the development of Mycobacterium smegmatis biofilms on hydroxyapatite surfaces. (2024)
- Mycobacterium abscessus Strain Morphotype Determines Phage Susceptibility, the Repertoire of Therapeutically Useful Phages, and Phage Resistance. (2021)
Caveat: IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge.
9 TB publications mention this gene. 9 publication(s) discuss this gene. **Its biology is documented at least as much OUTSIDE M. tuberculosis as within it** (7 papers in a non-TB mycobacterial context — M. smegmatis (7), M. abscessus (1) — vs 4 in a TB context). Mycobacterial genetics is largely done in M. smegmatis, so part of what is 'known' about this gene is known by proxy.
| Publication | Date |
|---|---|
| Beyond Inhibition: Sublethal Rifampicin-Induced Molecular Adaptations Confer Phenotypic Drug Tolerance in Mycobacteria. doi:10.1021/acsinfecdis.5c00701 | 2026 |
| Gene expression during the development of Mycobacterium smegmatis biofilms on hydroxyapatite surfaces. doi:10.1007/s10123-023-00385-7 | 2024 |
| Mycobacterium abscessus Strain Morphotype Determines Phage Susceptibility, the Repertoire of Therapeutically Useful Phages, and Phage Resistance. doi:10.1128/mBio.03431-20 | 2021 |
| Identification of new antibacterial targets in RNA polymerase of Mycobacterium tuberculosis by detecting positive selection sites. doi:10.1016/j.compbiolchem.2017.11.002 | 2018 |
| Proteomics and mass spectrometric studies reveal planktonic growth of Mycobacterium smegmatis in biofilm cultures in the absence of rpoZ. doi:10.1016/j.jchromb.2007.08.009 | 2008 |
IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 33% of residues (metapredict) · mean AlphaFold pLDDT 83.0 |
|---|---|
| Disordered regions | 1 IDR(s), longest 36 aa [0-36] |
carries a substantial disordered region (36/110 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index -9.28 (95% CI -12.26 to -6.12). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Promotes RNA polymerase assembly. Latches the N-and C-terminal regions of the beta' subunit thereby faciltating its interaction with the beta and alpha subunits [catalytic activity: N nucleoside triphosphate = N diphosphate + {RNA}N]. |
|---|---|
| Mycobrowser EC |
2.7.7.6
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1425
· 99.1% identity |
|---|---|
| M. leprae |
ML0542
· 90.9% identity |
| M. marinum |
MMAR_2203
· 93.6% identity |
| M. smegmatis |
MSMEG_3053
· 85.4% identity |
| M. orygis |
RJtmp_001470
· 99.1% identity |
| M. abscessus |
MAB_2822c
· 76.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGY5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | DNA-directed RNA polymerase subunit omega |
| EC (curated) |
EC 2.7.7.6
|
| Curated function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | rpoZ |
| eggNOG description | Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits |
| Orthologous group | COG1758 |
| EC number |
EC 2.7.7.6
|
| KEGG orthology |
K03060
|
| KEGG pathways |
map00230, map00240, map01100, map03020
|
| KEGG modules |
M00183
|
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0030312, GO:0040007, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.325 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 89.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 76.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 8 in the ORF — 8 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 8 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 8 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv1390-rpoZ_DAS #1 (TetON promoter -) |
|---|---|
| Baseline knockdown fitness | 4.769 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 514.0 ppm · rank 391/3519 (88.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 110 aa |
|---|---|
| Molecular weight | 11.8 kDa |
| Theoretical pI | 4.39 |
| GRAVY | -0.207 (hydrophilic) |
| Aliphatic index | 100.3 |
| Aromaticity | 0.064 |
| Instability index | 44.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RNA_pol_Rpb6 | PF01192.28 | 1.7e-13 | 42–104 | RNA polymerase Rpb6 |
Experimental structures (Protein Data Bank) 84 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7kin |
Electron Microscopy | 2.74 Å | 100% |
5zx3 |
X-ray diffraction | 2.751 Å | 100% |
5zx2 |
X-ray diffraction | 2.8 Å | 100% |
6koo |
X-ray diffraction | 2.8 Å | 100% |
8e95 |
Electron Microscopy | 2.9 Å | 100% |
6jcx |
X-ray diffraction | 2.903 Å | 100% |
7kif |
Electron Microscopy | 2.94 Å | 100% |
8e74 |
Electron Microscopy | 2.94 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (84 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6fbv-assembly1_E |
1.00 | 0.95 | 2.9e-11 sig | 6fbv-assembly1_E Single particle cryo em structure of Mycobacterium tuberculosis RNA polymerase in complex with Fidaxomicin |
6tyf-assembly1_E |
1.00 | 0.95 | 3.4e-11 sig | 6tyf-assembly1_E Crystal structure of MTB sigma L transcription initiation complex with 6 nt long RNA primer |
6c04-assembly1_E |
1.00 | 0.96 | 9.2e-11 sig | 6c04-assembly1_E Mtb RNAP Holo/RbpA/double fork DNA -closed clamp |
8hih-assembly1_E |
1.00 | 0.94 | 8.2e-11 sig | 8hih-assembly1_E Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with transcription factor GlnR |
7u22-assembly1_E |
1.00 | 0.96 | 1.4e-10 sig | 7u22-assembly1_E Mycobacterium tuberculosis RNA polymerase sigma A holoenzyme open promoter complex containing UMN-7 |
Foldseek search of the AlphaFold DB model (mean pLDDT 83.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | gmk (+ strand, 65 bp gap) |
|---|---|
| Downstream (3' on genome) | dfp (+ strand, 15 bp gap) |
| Predicted operon |
rpoZ · dfp
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3457c rpoA exp |
DNA-directed RNA polymerase subunit alpha | 999 | 1000 | coexpression:805 experimental:999 database:844 textmining:878 |
Rv0668 rpoC exp |
DNA-directed RNA polymerase subunit beta' | 999 | 1000 | experimental:999 database:844 textmining:856 |
Rv0667 rpoB exp |
DNA-directed RNA polymerase subunit beta | 999 | 1000 | coexpression:655 experimental:999 database:844 textmining:850 |
Rv2703 sigA exp |
RNA polymerase sigma factor SigA | 999 | 999 | experimental:999 |
Rv2050 rbpA exp |
RNA polymerase-binding protein RbpA | 998 | 999 ctx | cooccurence:729 experimental:995 |
Rv2101 helZ exp |
helicase HelZ | 986 | 986 | experimental:910 database:843 |
Rv2710 sigB exp |
RNA polymerase sigma factor SigB | 985 | 984 | experimental:983 |
Rv1329c dinG exp |
ATP-dependent helicase DinG | 977 | 976 | experimental:854 database:844 |
Rv3583c carD exp |
RNA polymerase-binding transcription factor CarD | 976 | 974 | experimental:960 |
Rv1389 gmk |
guanylate kinase | 997 | 970 ctx | neighborhood:796 coexpression:861 textmining:914 |
Rv0719 rplF exp |
50S ribosomal protein L6 | 962 | 961 | coexpression:671 experimental:885 |
Rv1388 mihF exp |
integration host factor MihF | 979 | 956 ctx | neighborhood:706 coexpression:686 experimental:449 textmining:560 |
Rv2890c rpsB exp |
30S ribosomal protein S2 | 958 | 946 | coexpression:731 experimental:792 |
Rv2841c nusA exp |
transcription termination/antitermination protein NusA | 981 | 944 | coexpression:413 experimental:882 textmining:675 |
Rv0651 rplJ exp |
50S ribosomal protein L10 | 917 | 907 | coexpression:796 experimental:474 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: DNA-directed RNA polymerase subunit omega
- MTBC0 PGAP product: DNA-directed RNA polymerase subunit omega
- Pfam (hmmscan --cut_ga): RNA_pol_Rpb6 PF01192.28 (E=2e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215906.1)
- Domains: Pfam-A via hmmscan --cut_ga — RNA_pol_Rpb6 (PF01192.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1758 - Curated reference: UniProt P9WGY5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
255 functional partner(s); context anchor
rbpA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001491|Rv1390|rpoZ MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHADLLEHTEGE
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rpoZ? Email the maintainer — the message is pre-filled with this gene's details.