rpoZ Family assigned · medium auto-curated

H37Rv Rv1390 · MTBC0 mtbc0_001491 · 110 aa · 1574437–1574769 (+) · RefSeq NP_215906.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA-directed RNA polymerase subunit omega
MTBC0 PGAP re-annotationDNA-directed RNA polymerase subunit omega
Revised (this work)DNA-directed RNA polymerase subunit omega. Pfam: RNA_pol_Rpb6 (PF01192.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGY5 SwissProt · reviewed · Evidence at protein level
UniProt nameDNA-directed RNA polymerase subunit omega
EC (curated) EC 2.7.7.6
Curated functionPromotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerpoZ
eggNOG descriptionPromotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits
Orthologous groupCOG1758
EC number EC 2.7.7.6
KEGG orthology K03060
KEGG pathways map00230, map00240, map01100, map03020
KEGG modules M00183
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0030312, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.325 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RNA_pol_Rpb6PF01192.28 1.7e-1342–104 RNA polymerase Rpb6

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rbpA (RNA polymerase-binding protein RbpA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 999 1000 coexpression:805 experimental:999 database:844 textmining:878
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 999 1000 experimental:999 database:844 textmining:856
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 999 1000 coexpression:655 experimental:999 database:844 textmining:850
Rv2703 sigA RNA polymerase sigma factor SigA 999 999 experimental:999
Rv2050 rbpA RNA polymerase-binding protein RbpA 998 999 ctx cooccurence:729 experimental:995
Rv2101 helZ helicase HelZ 986 986 experimental:910 database:843
Rv2710 sigB RNA polymerase sigma factor SigB 985 984 experimental:983
Rv1329c dinG ATP-dependent helicase DinG 977 976 experimental:854 database:844
Rv3583c carD RNA polymerase-binding transcription factor CarD 976 974 experimental:960
Rv1389 gmk guanylate kinase 997 970 ctx neighborhood:796 coexpression:861 textmining:914
Rv0719 rplF 50S ribosomal protein L6 962 961 coexpression:671 experimental:885
Rv1388 mihF integration host factor MihF 979 956 ctx neighborhood:706 coexpression:686 experimental:449 textmining:560
Rv2890c rpsB 30S ribosomal protein S2 958 946 coexpression:731 experimental:792
Rv2841c nusA transcription termination/antitermination protein NusA 981 944 coexpression:413 experimental:882 textmining:675
Rv0651 rplJ 50S ribosomal protein L10 917 907 coexpression:796 experimental:474

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: DNA-directed RNA polymerase subunit omega
  • MTBC0 PGAP product: DNA-directed RNA polymerase subunit omega
  • Pfam (hmmscan --cut_ga): RNA_pol_Rpb6 PF01192.28 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215906.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RNA_pol_Rpb6 (PF01192.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1758
  • Curated reference: UniProt P9WGY5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 255 functional partner(s); context anchor rbpA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001491|Rv1390|rpoZ
MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHADLLEHTEGE