Rv2687c Family assigned · medium auto-curated

H37Rv Rv2687c · MTBC0 mtbc0_002861 · 237 aa · 3026450–3027163 (-) · RefSeq NP_217203.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antibiotic ABC transporter permease
MTBC0 PGAP re-annotationfluoroquinolone transporter permease
Revised (this work)Fluoroquinolone transporter permease. Pfam: FLQE3_permease (PF24686.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJB1 SwissProt · reviewed · Evidence at protein level
UniProt nameFluoroquinolones export permease protein Rv2687c
Curated functionPart of the ABC transporter complex Rv2686c/Rv2687c/Rv2688c involved in fluoroquinolones export. Confers resistance to ciprofloxacin and, to a lesser extent, norfloxacin, moxifloxacin and sparfloxacin. Probably responsible for the translocation of the substrate across the membrane.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
P Inorganic ion transport and metabolism
eggNOG descriptionthought to be involved in active transport of unidentified antibiotic across the membrane (export) antibiotic resistance by an export mechanism. responsible for the translocation of the substrate across the membrane
Orthologous groupCOG1668
KEGG orthology K16906
KEGG pathways map02010
KEGG modules M00224
Gene Ontology (9) GO:0003674, GO:0005215, GO:0006810, GO:0008150, GO:0015562, GO:0022857, GO:0051179, GO:0051234, GO:0055085

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.258 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FLQE3_permeasePF24686.2 8.1e-1192–234 Fluoroquinolones export permease protein family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2686c (antibiotic ABC transporter permease), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2686c antibiotic ABC transporter permease 999 999 ctx neighborhood:882 cooccurence:774 coexpression:783 database:900
Rv2688c antibiotic ABC transporter ATP-binding protein 996 996 ctx neighborhood:781 cooccurence:765 database:900
Rv1978 hyp hypothetical protein 773 773 ctx cooccurence:772
Rv0210 hyp hypothetical protein 739 739 ctx cooccurence:739
Rv3912 rsmA anti-sigma-M factor RsmA 734 734 ctx cooccurence:734
Rv0955 integral membrane protein 700 700 ctx cooccurence:697
Rv1182 papA3 acyltransferase papA3 681 682 ctx cooccurence:640
Rv1181 pks4 polyketide beta-ketoacyl synthase 681 681 ctx cooccurence:640
Rv0097 oxidoreductase 673 673 ctx cooccurence:673
Rv0849 MFS-type transporter 667 667 ctx cooccurence:631
Rv3824c papA1 acyltransferase 651 652 ctx cooccurence:606
Rv0804 hyp hypothetical protein 646 634 ctx cooccurence:598
Rv3820c papA2 trehalose-2-sulfate acyltransferase 626 626 ctx cooccurence:578
Rv2633c hyp hypothetical protein 604 604 ctx cooccurence:604
Rv3405c HTH-type transcriptional regulator 603 604 ctx cooccurence:602

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antibiotic ABC transporter permease
  • MTBC0 PGAP product: fluoroquinolone transporter permease
  • Pfam (hmmscan --cut_ga): FLQE3_permease PF24686.2 (E=8e-119)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217203.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FLQE3_permease (PF24686.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1668
  • Curated reference: UniProt P9WJB1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor Rv2686c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002861|Rv2687c|
MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGFFFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLLPLVAGIVLGTLLMLLVGFSSSLPFASVTDWFLAAVIPLAIMLAPPVVHYSGLWPNPVLYLIPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL