Rv2687c Family assigned · medium auto-curated
H37Rv Rv2687c · MTBC0 mtbc0_002861 ·
237 aa · 3026450–3027163 (-) ·
RefSeq NP_217203.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antibiotic ABC transporter permease |
|---|---|
| MTBC0 PGAP re-annotation | fluoroquinolone transporter permease |
| Revised (this work) | Fluoroquinolone transporter permease. Pfam: FLQE3_permease (PF24686.2). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJB1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Fluoroquinolones export permease protein Rv2687c |
| Curated function | Part of the ABC transporter complex Rv2686c/Rv2687c/Rv2688c involved in fluoroquinolones export. Confers resistance to ciprofloxacin and, to a lesser extent, norfloxacin, moxifloxacin and sparfloxacin. Probably responsible for the translocation of the substrate across the membrane. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversionP Inorganic ion transport and metabolism
|
|---|---|
| eggNOG description | thought to be involved in active transport of unidentified antibiotic across the membrane (export) antibiotic resistance by an export mechanism. responsible for the translocation of the substrate across the membrane |
| Orthologous group | COG1668 |
| KEGG orthology |
K16906
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00224
|
| Gene Ontology (9) |
GO:0003674, GO:0005215, GO:0006810, GO:0008150, GO:0015562, GO:0022857, GO:0051179, GO:0051234, GO:0055085
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.258 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FLQE3_permease | PF24686.2 | 8.1e-119 | 2–234 | Fluoroquinolones export permease protein family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv2686c (antibiotic ABC transporter permease), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2686c |
antibiotic ABC transporter permease | 999 | 999 ctx | neighborhood:882 cooccurence:774 coexpression:783 database:900 |
Rv2688c |
antibiotic ABC transporter ATP-binding protein | 996 | 996 ctx | neighborhood:781 cooccurence:765 database:900 |
Rv1978 hyp |
hypothetical protein | 773 | 773 ctx | cooccurence:772 |
Rv0210 hyp |
hypothetical protein | 739 | 739 ctx | cooccurence:739 |
Rv3912 rsmA |
anti-sigma-M factor RsmA | 734 | 734 ctx | cooccurence:734 |
Rv0955 |
integral membrane protein | 700 | 700 ctx | cooccurence:697 |
Rv1182 papA3 |
acyltransferase papA3 | 681 | 682 ctx | cooccurence:640 |
Rv1181 pks4 |
polyketide beta-ketoacyl synthase | 681 | 681 ctx | cooccurence:640 |
Rv0097 |
oxidoreductase | 673 | 673 ctx | cooccurence:673 |
Rv0849 |
MFS-type transporter | 667 | 667 ctx | cooccurence:631 |
Rv3824c papA1 |
acyltransferase | 651 | 652 ctx | cooccurence:606 |
Rv0804 hyp |
hypothetical protein | 646 | 634 ctx | cooccurence:598 |
Rv3820c papA2 |
trehalose-2-sulfate acyltransferase | 626 | 626 ctx | cooccurence:578 |
Rv2633c hyp |
hypothetical protein | 604 | 604 ctx | cooccurence:604 |
Rv3405c |
HTH-type transcriptional regulator | 603 | 604 ctx | cooccurence:602 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antibiotic ABC transporter permease
- MTBC0 PGAP product: fluoroquinolone transporter permease
- Pfam (hmmscan --cut_ga): FLQE3_permease PF24686.2 (E=8e-119)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217203.1)
- Domains: Pfam-A via hmmscan --cut_ga — FLQE3_permease (PF24686.2)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1668 - Curated reference: UniProt P9WJB1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
Rv2686c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002861|Rv2687c| MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGFFFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLLPLVAGIVLGTLLMLLVGFSSSLPFASVTDWFLAAVIPLAIMLAPPVVHYSGLWPNPVLYLIPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL