ppgK Family assigned · medium auto-curated

H37Rv Rv2702 · MTBC0 mtbc0_002876 · 265 aa · 3039273–3040070 (+) · RefSeq NP_217218.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)polyphosphate glucokinase
MTBC0 PGAP re-annotationROK family protein
Revised (this work)ROK family protein. Pfam: ROK (PF00480.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIN1 SwissProt · reviewed · Evidence at protein level
UniProt namePolyphosphate glucokinase
EC (curated) EC 2.7.1.2, EC 2.7.1.63
Curated functionCatalyzes the phosphorylation of glucose using polyphosphate or ATP as the phosphoryl donor. Polyphosphate, rather than ATP, seems to be the major phosphate donor for the enzyme in M.tuberculosis (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred nameppgK
eggNOG descriptioncatalyzes the phosphorylation of glucose using polyphosphate or ATP as the phosphoryl donor
Orthologous groupCOG1940
EC number EC 2.7.1.2, EC 2.7.1.63
KEGG orthology K00845, K00886
KEGG pathways map00010, map00052, map00500, map00520, map00521, map00524, map01100, map01110, map01120, map01130, map01200
KEGG modules M00001, M00549
Gene Ontology (26) GO:0003674, GO:0003824, GO:0004340, GO:0004396, GO:0005975, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0009987, GO:0016301, GO:0016310 +14 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.16 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 10 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ROKPF00480.27 2.3e-1322–175 ROK family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigA (RNA polymerase sigma factor SigA), high confidence from genomic context alone (score 742 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0946c pgi glucose-6-phosphate isomerase 952 906 database:900 textmining:509
Rv3068c pgmA phosphoglucomutase PgmA 939 904 database:900
Rv0650 sugar kinase 980 900 database:900 textmining:816
Rv1448c tal transaldolase 904 844 database:800 textmining:414
Rv1449c tkt transketolase 856 817 database:800
Rv1121 zwf1 glucose-6-phosphate 1-dehydrogenase 862 812 database:800
Rv1447c zwf2 glucose-6-phosphate 1-dehydrogenase 848 811 database:800
Rv0363c fba fructose-bisphosphate aldolase 866 809 database:800
Rv0478 deoC 2-deoxyribose-5-phosphate aldolase 806 806 database:800
Rv2703 sigA RNA polymerase sigma factor SigA 752 742 ctx neighborhood:741
Rv2701c suhB inositol-1-monophosphatase SuhB 628 628 ctx neighborhood:626
Rv2704 hyp hypothetical protein 491 468 ctx neighborhood:468
Rv2753c dapA 4-hydroxy-tetrahydrodipicolinate synthase 457 399
Rv2984 ppk1 polyphosphate kinase 424 197
Rv3232c ppk2 polyphosphate kinase 578 194 textmining:499

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: polyphosphate glucokinase
  • MTBC0 PGAP product: ROK family protein
  • Pfam (hmmscan --cut_ga): ROK PF00480.27 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217218.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ROK (PF00480.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1940
  • Curated reference: UniProt P9WIN1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor sigA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002876|Rv2702|ppgK
MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTILNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDWTYPKWAKQVTRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIVGAAMASVADTTH