ppgK Family assigned · medium auto-curated
H37Rv Rv2702 · MTBC0 mtbc0_002876 ·
265 aa · 3039273–3040070 (+) ·
RefSeq NP_217218.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | polyphosphate glucokinase |
|---|---|
| MTBC0 PGAP re-annotation | ROK family protein |
| Revised (this work) | ROK family protein. Pfam: ROK (PF00480.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIN1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Polyphosphate glucokinase |
| EC (curated) |
EC 2.7.1.2, EC 2.7.1.63
|
| Curated function | Catalyzes the phosphorylation of glucose using polyphosphate or ATP as the phosphoryl donor. Polyphosphate, rather than ATP, seems to be the major phosphate donor for the enzyme in M.tuberculosis (By similarity). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| Preferred name | ppgK |
| eggNOG description | catalyzes the phosphorylation of glucose using polyphosphate or ATP as the phosphoryl donor |
| Orthologous group | COG1940 |
| EC number |
EC 2.7.1.2, EC 2.7.1.63
|
| KEGG orthology |
K00845, K00886
|
| KEGG pathways |
map00010, map00052, map00500, map00520, map00521, map00524, map01100, map01110, map01120, map01130, map01200
|
| KEGG modules |
M00001, M00549
|
| Gene Ontology (26) |
GO:0003674, GO:0003824, GO:0004340, GO:0004396, GO:0005975, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0009987, GO:0016301, GO:0016310 +14 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.16 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 10 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ROK | PF00480.27 | 2.3e-13 | 22–175 | ROK family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: sigA (RNA polymerase sigma factor SigA), high confidence from genomic context alone (score 742 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0946c pgi |
glucose-6-phosphate isomerase | 952 | 906 | database:900 textmining:509 |
Rv3068c pgmA |
phosphoglucomutase PgmA | 939 | 904 | database:900 |
Rv0650 |
sugar kinase | 980 | 900 | database:900 textmining:816 |
Rv1448c tal |
transaldolase | 904 | 844 | database:800 textmining:414 |
Rv1449c tkt |
transketolase | 856 | 817 | database:800 |
Rv1121 zwf1 |
glucose-6-phosphate 1-dehydrogenase | 862 | 812 | database:800 |
Rv1447c zwf2 |
glucose-6-phosphate 1-dehydrogenase | 848 | 811 | database:800 |
Rv0363c fba |
fructose-bisphosphate aldolase | 866 | 809 | database:800 |
Rv0478 deoC |
2-deoxyribose-5-phosphate aldolase | 806 | 806 | database:800 |
Rv2703 sigA |
RNA polymerase sigma factor SigA | 752 | 742 ctx | neighborhood:741 |
Rv2701c suhB |
inositol-1-monophosphatase SuhB | 628 | 628 ctx | neighborhood:626 |
Rv2704 hyp |
hypothetical protein | 491 | 468 ctx | neighborhood:468 |
Rv2753c dapA |
4-hydroxy-tetrahydrodipicolinate synthase | 457 | 399 | |
Rv2984 ppk1 |
polyphosphate kinase | 424 | 197 | |
Rv3232c ppk2 |
polyphosphate kinase | 578 | 194 | textmining:499 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: polyphosphate glucokinase
- MTBC0 PGAP product: ROK family protein
- Pfam (hmmscan --cut_ga): ROK PF00480.27 (E=2e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217218.1)
- Domains: Pfam-A via hmmscan --cut_ga — ROK (PF00480.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1940 - Curated reference: UniProt P9WIN1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
30 functional partner(s); context anchor
sigA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002876|Rv2702|ppgK MTSTGPETSETPGATTQRHGFGIDVGGSGIKGGIVDLDTGQLIGDRIKLLTPQPATPLAVAKTIAEVVNGFGWRGPLGVTYPGVVTHGVVRTAANVDKSWIGTNARDTIGAELGGQQVTILNDADAAGLAETRYGAGKNNPGLVVLLTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEERAASSVKEKNDWTYPKWAKQVTRVLIAIENAIWPDLFIAGGGISRKADKWVPLLENRTPVVPAALQNTAGIVGAAMASVADTTH