ideR Family assigned · medium auto-curated

H37Rv Rv2711 · MTBC0 mtbc0_002885 · 230 aa · 3045980–3046672 (+) · RefSeq NP_217227.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)iron-dependent repressor and activator IdeR
MTBC0 PGAP re-annotationiron-dependent transcriptional regulator IdeR
Revised (this work)Iron-dependent transcriptional regulator IdeR. Pfam: Fe_dep_repress (PF01325.26), Fe_dep_repr_C (PF02742.22), DtxR (PF18357.8), FeoA (PF04023.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMH1 SwissProt · reviewed · Evidence at protein level
UniProt nameIron-dependent repressor IdeR
Curated functionMetal-dependent DNA-binding protein that controls transcription of many genes involved in iron metabolism. Acts as a repressor of siderophore biosynthesis and as a positive modulator of iron storage. Also regulates expression of transporters, proteins involved in siderophore synthesis, iron storage and transcriptional regulators.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameideR
eggNOG descriptionrepressor
Orthologous groupCOG1321
KEGG orthology K03709
Gene Ontology (96) GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0005506, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005886, GO:0006355 +84 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Fe_dep_repressPF01325.26 4.4e-213–62 Iron dependent repressor, N-terminal DNA binding domain
Fe_dep_repr_CPF02742.22 1.6e-3065–133 Iron dependent repressor, metal binding and dimerisation domain
DtxRPF18357.8 9.5e-10152–229 Diphteria toxin repressor SH3 domain
FeoAPF04023.21 2.5e-08152–229 FeoA domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigB (RNA polymerase sigma factor SigB), high confidence from genomic context alone (score 928 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2710 sigB RNA polymerase sigma factor SigB 943 928 ctx neighborhood:756 coexpression:716
Rv0983 pepD serine protease PepD 761 762 coexpression:757
Rv2744c 35kd_ag hyp hypothetical protein 740 731 coexpression:731
Rv2917 hyp hypothetical protein 580 580 ctx cooccurence:478
Rv2709 transmembrane protein 559 559 ctx neighborhood:486
Rv3859c gltB glutamate synthase large subunit 547 548 ctx neighborhood:544
Rv0082 oxidoreductase 468 468 experimental:468
Rv3258c hyp hypothetical protein 466 466 ctx cooccurence:461
Rv1932 tpx 2-Cys peroxiredoxin 476 448 coexpression:416
Rv2256c hyp hypothetical protein 446 446 ctx cooccurence:429
Rv2359 zur zinc uptake regulation protein 877 440 coexpression:421 textmining:789
Rv1909c furA ferric uptake regulation protein FurA 672 439 coexpression:420 textmining:439
Rv2216 epimerase family protein 437 438 coexpression:438
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 425 426 ctx cooccurence:417
Rv2903c lepB signal peptidase 423 424 coexpression:424

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: iron-dependent repressor and activator IdeR
  • MTBC0 PGAP product: iron-dependent transcriptional regulator IdeR
  • Pfam (hmmscan --cut_ga): Fe_dep_repress PF01325.26 (E=4e-21), Fe_dep_repr_C PF02742.22 (E=2e-30), DtxR PF18357.8 (E=1e-09), FeoA PF04023.21 (E=2e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217227.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Fe_dep_repress (PF01325.26), Fe_dep_repr_C (PF02742.22), DtxR (PF18357.8), FeoA (PF04023.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1321
  • Curated reference: UniProt P9WMH1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor sigB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002885|Rv2711|ideR
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV