rpsQ Resolved · high auto-curated

H37Rv Rv0710 · MTBC0 mtbc0_000752 · 136 aa · 809949–810359 MTBC0 (+) · RefSeq NP_215224.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand mftD (Rv0694) — requalified: pre-mycofactocin synthase MftD mftE (Rv0695) — requalified: mycofactocin biosynthesis peptidyl-dipeptidase MftE mftF (Rv0696) — requalified: mycofactocin biosynthesis glycosyltransferase MftF mftF mftG (Rv0697) — family_assigned: mycofactocin system GMC family oxidoreductase MftG mftG Rv0699 (Rv0699) — dark: hypothetical protein rplC (Rv0701) — requalified: 50S ribosomal protein L3 rplD (Rv0702) — requalified: 50S ribosomal protein L4 rplW (Rv0703) — requalified: 50S ribosomal protein L23 rplB (Rv0704) — requalified: 50S ribosomal protein L2 rplB rpsS (Rv0705) — requalified: 30S ribosomal protein S19 rplV (Rv0706) — requalified: 50S ribosomal protein L22 rpsC (Rv0707) — requalified: 30S ribosomal protein S3 rpsC rplP (Rv0708) — requalified: 50S ribosomal protein L16 rpmC (Rv0709) — requalified: 50S ribosomal protein L29 rpsQ (Rv0710) — requalified: 30S ribosomal protein S17 atsA (Rv0711) — requalified: arylsulfatase AtsA atsA Rv0712 (Rv0712) — family_assigned: formylglycine-generating enzyme family protein Rv0712 Rv0713 (Rv0713) — dark: DUF4436 domain-containing protein Rv0713 rplX (Rv0715) — requalified: 50S ribosomal protein L24 rplE (Rv0716) — requalified: 50S ribosomal protein L5 rplR (Rv0720) — requalified: 50S ribosomal protein L18 rpsE (Rv0721) — requalified: 30S ribosomal protein S5 rpmD (Rv0722) — requalified: 50S ribosomal protein L30 rplO (Rv0723) — requalified: 50S ribosomal protein L15 800 kb 804 kb 808 kb 812 kb 816 kb 820 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S17
MTBC0 PGAP re-annotation30S ribosomal protein S17
Revised (this work)30S ribosomal protein S17. Pfam: Ribosomal_S17 (PF00366.27).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 3 publications

3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
Extra-ribosomal functions of Mtb RpsB in imparting stress resilience and drug tolerance to mycobacteria. doi:10.1016/j.biochi.2020.08.007 2020
Identification of idiosyncratic Mycobacterium tuberculosis ribosomal protein subunits with implications in extraribosomal function, persistence, and drug resistance based on transcriptome data. doi:10.1080/07391102.2013.826143 2014
Small genes/gene-products in Escherichia coli K-12. doi:10.1111/j.1574-6968.1998.tb13343.x 1998

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder43% of residues (metapredict) · mean AlphaFold pLDDT 80.8
Disordered regions1 IDR(s), longest 59 aa [0-59]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourrpmC (Rv0709, + strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): WhiB1 (whiB1).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index -17.59 (95% CI -18.50 to -16.62). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionProtein S17 binds specifically to the 5' end of 16S ribosomal RNA.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0730 · 99.3% identity
M. leprae ML1854c · 76.1% identity
M. marinum MMAR_1040 · 76.5% identity
M. smegmatis MSMEG_1445 · 87.6% identity
M. orygis RJtmp_000748 · 99.3% identity
M. abscessus MAB_3811c · 83.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WH51 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS17
Curated functionOne of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsQ
eggNOG descriptionOne of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA
Orthologous groupCOG0186
KEGG orthology K02961
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (55) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006412, GO:0006518 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.663 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.111 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 94.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 75.4%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 12 in the ORF — 10 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 0.167, mean read count 194. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainRv0710 (rpsQ) -FLAG/DAS+pTetON-18 sspB (TetON promoter 18)
Baseline knockdown fitness2.938 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 13 of 16 independent MS datasets
Integrated abundance1478.0 ppm · rank 142/3519 (96.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length136 aa
Molecular weight14.9 kDa
Theoretical pI10.57
GRAVY-0.665 (hydrophilic)
Aliphatic index74.8
Aromaticity0.022
Instability index23.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S17PF00366.27 3.3e-2963–130 Ribosomal protein S17

Experimental structures (Protein Data Bank) 10 solved

PDBMethodResolutionCoverage
7sfr Electron Microscopy 2.6 Å 100%
7kgb Electron Microscopy 2.7 Å 100%
7mt7 Electron Microscopy 2.71 Å 100%
7mt2 Electron Microscopy 2.76 Å 100%
7msm Electron Microscopy 2.79 Å 100%
7mt3 Electron Microscopy 2.8 Å 100%
7msc Electron Microscopy 2.97 Å 100%
7msz Electron Microscopy 3.1 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (10 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 80.8

PDB hitprobTM-scoreE-valueDescription
8whx-assembly1_r 1.00 0.97 3.2e-14 sig 8whx-assembly1_r Cryo- EM structure of Mycobacterium smegmatis 70S ribosome and RafH.
5v93-assembly1_q 1.00 0.94 1.5e-14 sig 5v93-assembly1_q Cryo-EM structure of the 70S ribosome from Mycobacterium tuberculosis bound with Capreomycin
5xyu-assembly1_Q 1.00 0.95 1.5e-12 sig 5xyu-assembly1_Q Small subunit of Mycobacterium smegmatis ribosome
8cwo-assembly1_Q 1.00 0.97 2.1e-11 sig 8cwo-assembly1_Q Cutibacterium acnes 30S ribosomal subunit with Sarecycline bound, body domain only in the local refined map
8fmw-assembly1_Q 1.00 0.96 5.7e-11 sig 8fmw-assembly1_Q The structure of a hibernating ribosome in the Lyme disease pathogen

Foldseek search of the AlphaFold DB model (mean pLDDT 80.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 7

Upstream (5' on genome)rpmC (+ strand, -4 bp gap)
Downstream (3' on genome)atsA (+ strand, 168 bp gap)
Predicted operon rplB · rpsS · rplV · rpsC · rplP · rpmC · rpsQ

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv1049 (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: rpsI (30S ribosomal protein S9), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0717 rpsN1 exp 30S ribosomal protein S14 999 1000 coexpression:738 experimental:999 database:662
Rv0682 rpsL exp 30S ribosomal protein S12 999 1000 coexpression:863 experimental:999 database:844
Rv1643 rplT exp 50S ribosomal protein L20 999 1000 coexpression:840 experimental:999
Rv3442c rpsI exp 30S ribosomal protein S9 999 1000 ctx cooccurence:411 coexpression:834 experimental:999 database:540
Rv0706 rplV exp 50S ribosomal protein L22 999 1000 ctx neighborhood:882 cooccurence:705 coexpression:969 experimental:999 textmining:548
Rv3459c rpsK exp 30S ribosomal protein S11 999 1000 ctx cooccurence:441 coexpression:862 experimental:999 database:925
Rv0700 rpsJ exp 30S ribosomal protein S10 999 1000 ctx neighborhood:728 coexpression:865 experimental:999 database:844 textmining:406
Rv0723 rplO exp 50S ribosomal protein L15 999 1000 ctx cooccurence:438 coexpression:968 experimental:999 textmining:470
Rv0707 rpsC exp 30S ribosomal protein S3 999 1000 ctx neighborhood:882 coexpression:972 experimental:999 database:925 textmining:516
Rv2442c rplU exp 50S ribosomal protein L21 999 1000 coexpression:827 experimental:999
Rv0722 rpmD exp 50S ribosomal protein L30 999 1000 coexpression:943 experimental:999
Rv0056 rplI exp 50S ribosomal protein L9 999 1000 coexpression:847 experimental:999 textmining:568
Rv3443c rplM exp 50S ribosomal protein L13 999 1000 coexpression:863 experimental:999 textmining:427
Rv0719 rplF exp 50S ribosomal protein L6 999 1000 ctx cooccurence:436 coexpression:918 experimental:999 textmining:429
Rv0702 rplD exp 50S ribosomal protein L4 999 1000 ctx neighborhood:739 coexpression:886 experimental:999 database:844

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S17
  • MTBC0 PGAP product: 30S ribosomal protein S17
  • Pfam (hmmscan --cut_ga): Ribosomal_S17 PF00366.27 (E=3e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215224.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S17 (PF00366.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0186
  • Curated reference: UniProt P9WH51 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 80.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 292 functional partner(s); context anchor rpsI
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000752|Rv0710|rpsQ
MMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETRPLSATKRWRLVEILEKAK