rpsQ Resolved · high auto-curated
H37Rv Rv0710 · MTBC0 mtbc0_000752 ·
136 aa · 809949–810359 (+) ·
RefSeq NP_215224.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S17 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S17 |
| Revised (this work) | 30S ribosomal protein S17. Pfam: Ribosomal_S17 (PF00366.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WH51
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Small ribosomal subunit protein uS17 |
| Curated function | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsQ |
| eggNOG description | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA |
| Orthologous group | COG0186 |
| KEGG orthology |
K02961
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178, M00179
|
| Gene Ontology (55) |
GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006412, GO:0006518 +43 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.663 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S17 | PF00366.27 | 3.3e-29 | 63–130 | Ribosomal protein S17 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rpsI (30S ribosomal protein S9), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0717 rpsN1 |
30S ribosomal protein S14 | 999 | 1000 | coexpression:738 experimental:999 database:662 |
Rv0682 rpsL |
30S ribosomal protein S12 | 999 | 1000 | coexpression:863 experimental:999 database:844 |
Rv1643 rplT |
50S ribosomal protein L20 | 999 | 1000 | coexpression:840 experimental:999 |
Rv3442c rpsI |
30S ribosomal protein S9 | 999 | 1000 ctx | cooccurence:411 coexpression:834 experimental:999 database:540 |
Rv0706 rplV |
50S ribosomal protein L22 | 999 | 1000 ctx | neighborhood:882 cooccurence:705 coexpression:969 experimental:999 textmining:548 |
Rv3459c rpsK |
30S ribosomal protein S11 | 999 | 1000 ctx | cooccurence:441 coexpression:862 experimental:999 database:925 |
Rv0700 rpsJ |
30S ribosomal protein S10 | 999 | 1000 ctx | neighborhood:728 coexpression:865 experimental:999 database:844 textmining:406 |
Rv0723 rplO |
50S ribosomal protein L15 | 999 | 1000 ctx | cooccurence:438 coexpression:968 experimental:999 textmining:470 |
Rv0707 rpsC |
30S ribosomal protein S3 | 999 | 1000 ctx | neighborhood:882 coexpression:972 experimental:999 database:925 textmining:516 |
Rv2442c rplU |
50S ribosomal protein L21 | 999 | 1000 | coexpression:827 experimental:999 |
Rv0722 rpmD |
50S ribosomal protein L30 | 999 | 1000 | coexpression:943 experimental:999 |
Rv0056 rplI |
50S ribosomal protein L9 | 999 | 1000 | coexpression:847 experimental:999 textmining:568 |
Rv3443c rplM |
50S ribosomal protein L13 | 999 | 1000 | coexpression:863 experimental:999 textmining:427 |
Rv0719 rplF |
50S ribosomal protein L6 | 999 | 1000 ctx | cooccurence:436 coexpression:918 experimental:999 textmining:429 |
Rv0702 rplD |
50S ribosomal protein L4 | 999 | 1000 ctx | neighborhood:739 coexpression:886 experimental:999 database:844 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S17
- MTBC0 PGAP product: 30S ribosomal protein S17
- Pfam (hmmscan --cut_ga): Ribosomal_S17 PF00366.27 (E=3e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215224.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S17 (PF00366.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0186 - Curated reference: UniProt P9WH51 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
292 functional partner(s); context anchor
rpsI - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000752|Rv0710|rpsQ MMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETRPLSATKRWRLVEILEKAK