rplX Resolved · high auto-curated

H37Rv Rv0715 · MTBC0 mtbc0_000757 · 105 aa · 815935–816252 (+) · RefSeq NP_215229.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L24
MTBC0 PGAP re-annotation50S ribosomal protein L24
Revised (this work)50S ribosomal protein L24. Pfam: KOW (PF00467.36), ribosomal_L24 (PF17136.11).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHB7 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL24
Curated functionOne of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit..; FUNCTION: One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplX
eggNOG descriptionOne of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit
Orthologous groupCOG0198
KEGG orthology K02895
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (52) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0006412, GO:0006518, GO:0006807, GO:0008150, GO:0008152 +40 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.657 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
KOWPF00467.36 7.7e-115–36 KOW motif
ribosomal_L24PF17136.11 1.1e-2338–105 Large ribosomal subunit protein uL24, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplR (50S ribosomal protein L18), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:705 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:753 experimental:999 textmining:436
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:857 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 ctx neighborhood:727 coexpression:888 experimental:999 database:694
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:889 experimental:999
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:967 experimental:999 database:623
Rv3443c rplM 50S ribosomal protein L13 999 1000 ctx cooccurence:419 coexpression:866 experimental:999 database:590
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx neighborhood:727 coexpression:971 experimental:999 database:715
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:805 experimental:999 textmining:480
Rv0722 rpmD 50S ribosomal protein L30 999 1000 ctx neighborhood:714 coexpression:877 experimental:999 database:754
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:901 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:914 experimental:999
Rv0723 rplO 50S ribosomal protein L15 999 1000 ctx neighborhood:714 coexpression:887 experimental:999 database:546
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:864 experimental:999
Rv0706 rplV 50S ribosomal protein L22 999 1000 coexpression:911 experimental:999 database:799

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L24
  • MTBC0 PGAP product: 50S ribosomal protein L24
  • Pfam (hmmscan --cut_ga): KOW PF00467.36 (E=8e-11), ribosomal_L24 PF17136.11 (E=1e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215229.1)
  • Domains: Pfam-A via hmmscan --cut_ga — KOW (PF00467.36), ribosomal_L24 (PF17136.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0198
  • Curated reference: UniProt P9WHB7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 274 functional partner(s); context anchor rplR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000757|Rv0715|rplX
MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHTAISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKDI