rpsN1 Resolved · high auto-curated

H37Rv Rv0717 · MTBC0 - · 61 aa · 812627–812812 (+) · RefSeq YP_177747.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S14
MTBC0 PGAP re-annotation
Revised (this work)30S ribosomal protein S14. Pfam: Ribosomal_S14 (PF00253.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH57 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS14B
Curated functionBinds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsN
eggNOG descriptionBinds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site
Orthologous groupCOG0199
KEGG orthology K02954
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (47) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005840, GO:0006412, GO:0006518, GO:0006807, GO:0008150 +35 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 4.39% of strains (6370) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S14PF00253.28 2.2e-2510–60 Ribosomal protein S14p/S29e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplO (50S ribosomal protein L15), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3442c rpsI 30S ribosomal protein S9 999 1000 coexpression:717 experimental:999 database:662
Rv0682 rpsL 30S ribosomal protein S12 999 1000 coexpression:734 experimental:999 database:662
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:720 experimental:999
Rv0723 rplO 50S ribosomal protein L15 999 1000 ctx neighborhood:714 coexpression:738 experimental:999
Rv0706 rplV 50S ribosomal protein L22 999 1000 coexpression:743 experimental:999
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:734 experimental:999 database:662
Rv0700 rpsJ 30S ribosomal protein S10 999 1000 coexpression:735 experimental:999 database:662
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:737 experimental:999 database:662
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:733 experimental:999
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx neighborhood:727 coexpression:740 experimental:999 textmining:403
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:738 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:742 experimental:999 database:662 textmining:445
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:724 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 ctx neighborhood:714 coexpression:734 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:725 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 30S ribosomal protein S14
  • Pfam (hmmscan --cut_ga): Ribosomal_S14 PF00253.28 (E=2e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177747.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S14 (PF00253.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0199
  • Curated reference: UniProt P9WH57 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 180 functional partner(s); context anchor rplO
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0717|rpsN1
MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLREMAHAGELPGVQKSSW