rplP Resolved · high auto-curated

H37Rv Rv0708 · MTBC0 mtbc0_000750 · 138 aa · 809303–809719 (+) · RefSeq NP_215222.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L16
MTBC0 PGAP re-annotation50S ribosomal protein L16
Revised (this work)50S ribosomal protein L16. Pfam: Ribosomal_L16 (PF00252.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHD5 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL16
Curated functionBinds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplP
eggNOG descriptionBinds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs
Orthologous groupCOG0197
KEGG orthology K02878
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (36) GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840 +24 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L16PF00252.25 5.8e-524–132 Ribosomal protein L16p/L10e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsD (30S ribosomal protein S4), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3458c rpsD 30S ribosomal protein S4 999 1000 ctx cooccurence:496 coexpression:865 experimental:999
Rv0703 rplW 50S ribosomal protein L23 999 1000 ctx neighborhood:739 coexpression:968 experimental:999 database:652 textmining:528
Rv0683 rpsG 30S ribosomal protein S7 999 1000 ctx cooccurence:705 coexpression:861 experimental:999
Rv0718 rpsH 30S ribosomal protein S8 999 1000 ctx cooccurence:606 coexpression:963 experimental:999
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:810 experimental:999 textmining:604
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 coexpression:734 experimental:999
Rv0704 rplB 50S ribosomal protein L2 999 1000 ctx neighborhood:822 cooccurence:734 coexpression:995 experimental:999 database:497 textmining:693
Rv0705 rpsS 30S ribosomal protein S19 999 1000 ctx neighborhood:882 cooccurence:752 coexpression:996 experimental:999 textmining:619
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:861 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 ctx neighborhood:882 cooccurence:424 coexpression:975 experimental:999 textmining:625
Rv0715 rplX 50S ribosomal protein L24 999 1000 coexpression:882 experimental:999 database:516 textmining:430
Rv2785c rpsO 30S ribosomal protein S15 999 1000 ctx cooccurence:414 coexpression:863 experimental:999
Rv0716 rplE 50S ribosomal protein L5 999 1000 ctx cooccurence:609 coexpression:886 experimental:999 database:461 textmining:702
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:865 experimental:999
Rv0709 rpmC 50S ribosomal protein L29 999 1000 ctx neighborhood:882 coexpression:987 experimental:999 database:461

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L16
  • MTBC0 PGAP product: 50S ribosomal protein L16
  • Pfam (hmmscan --cut_ga): Ribosomal_L16 PF00252.25 (E=6e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215222.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L16 (PF00252.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0197
  • Curated reference: UniProt P9WHD5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 278 functional partner(s); context anchor rpsD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000750|Rv0708|rplP
MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTRAIHKLPIKARIITREEQF