rplP Resolved · high auto-curated
H37Rv Rv0708 · MTBC0 mtbc0_000750 ·
138 aa · 809303–809719 (+) ·
RefSeq NP_215222.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 50S ribosomal protein L16 |
|---|---|
| MTBC0 PGAP re-annotation | 50S ribosomal protein L16 |
| Revised (this work) | 50S ribosomal protein L16. Pfam: Ribosomal_L16 (PF00252.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WHD5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Large ribosomal subunit protein uL16 |
| Curated function | Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rplP |
| eggNOG description | Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs |
| Orthologous group | COG0197 |
| KEGG orthology |
K02878
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (36) |
GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840 +24 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_L16 | PF00252.25 | 5.8e-52 | 4–132 | Ribosomal protein L16p/L10e |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rpsD (30S ribosomal protein S4), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3458c rpsD |
30S ribosomal protein S4 | 999 | 1000 ctx | cooccurence:496 coexpression:865 experimental:999 |
Rv0703 rplW |
50S ribosomal protein L23 | 999 | 1000 ctx | neighborhood:739 coexpression:968 experimental:999 database:652 textmining:528 |
Rv0683 rpsG |
30S ribosomal protein S7 | 999 | 1000 ctx | cooccurence:705 coexpression:861 experimental:999 |
Rv0718 rpsH |
30S ribosomal protein S8 | 999 | 1000 ctx | cooccurence:606 coexpression:963 experimental:999 |
Rv2904c rplS |
50S ribosomal protein L19 | 999 | 1000 | coexpression:810 experimental:999 textmining:604 |
Rv0055 rpsR1 |
30S ribosomal protein S18 | 999 | 1000 | coexpression:734 experimental:999 |
Rv0704 rplB |
50S ribosomal protein L2 | 999 | 1000 ctx | neighborhood:822 cooccurence:734 coexpression:995 experimental:999 database:497 textmining:693 |
Rv0705 rpsS |
30S ribosomal protein S19 | 999 | 1000 ctx | neighborhood:882 cooccurence:752 coexpression:996 experimental:999 textmining:619 |
Rv0053 rpsF |
30S ribosomal protein S6 | 999 | 1000 | coexpression:861 experimental:999 |
Rv0710 rpsQ |
30S ribosomal protein S17 | 999 | 1000 ctx | neighborhood:882 cooccurence:424 coexpression:975 experimental:999 textmining:625 |
Rv0715 rplX |
50S ribosomal protein L24 | 999 | 1000 | coexpression:882 experimental:999 database:516 textmining:430 |
Rv2785c rpsO |
30S ribosomal protein S15 | 999 | 1000 ctx | cooccurence:414 coexpression:863 experimental:999 |
Rv0716 rplE |
50S ribosomal protein L5 | 999 | 1000 ctx | cooccurence:609 coexpression:886 experimental:999 database:461 textmining:702 |
Rv3461c rpmJ |
50S ribosomal protein L36 | 999 | 1000 | coexpression:865 experimental:999 |
Rv0709 rpmC |
50S ribosomal protein L29 | 999 | 1000 ctx | neighborhood:882 coexpression:987 experimental:999 database:461 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 50S ribosomal protein L16
- MTBC0 PGAP product: 50S ribosomal protein L16
- Pfam (hmmscan --cut_ga): Ribosomal_L16 PF00252.25 (E=6e-52)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215222.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L16 (PF00252.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0197 - Curated reference: UniProt P9WHD5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
278 functional partner(s); context anchor
rpsD - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000750|Rv0708|rplP MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTRAIHKLPIKARIITREEQF