rplP Resolved · high auto-curated
H37Rv Rv0708 · MTBC0 mtbc0_000750 ·
138 aa ·
809303–809719 MTBC0
(+) ·
RefSeq NP_215222.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 50S ribosomal protein L16 |
|---|---|
| MTBC0 PGAP re-annotation | 50S ribosomal protein L16 |
| Revised (this work) | 50S ribosomal protein L16. Pfam: Ribosomal_L16 (PF00252.25). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Identification of idiosyncratic Mycobacterium tuberculosis ribosomal protein subunits with implications in extraribosomal function, persistence, and drug resistance based on transcriptome data. doi:10.1080/07391102.2013.826143 | 2014 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | rpmC (Rv0709, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB1 (whiB1).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -12.82 (95% CI -14.66 to -10.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | This protein binds directly to 23S ribosomal RNA and is located at the a site of the peptidyltransferase center. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0728
· 100.0% identity |
|---|---|
| M. leprae |
ML1856c
· 96.4% identity |
| M. marinum |
MMAR_1038
· 97.8% identity |
| M. smegmatis |
MSMEG_1443
· 93.5% identity |
| M. orygis |
RJtmp_000746
· 100.0% identity |
| M. abscessus |
MAB_3813c
· 92.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHD5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Large ribosomal subunit protein uL16 |
| Curated function | Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rplP |
| eggNOG description | Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs |
| Orthologous group | COG0197 |
| KEGG orthology |
K02878
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (36) |
GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840 +24 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 6 consensus substitution(s) low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 95.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 75.5% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 10 in the ORF — 9 in the essential state, 1 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.100, mean read count 18. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0708 (rplP) -FLAG/DAS+pTetON-18 sspB (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 3.14 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1682.0 ppm · rank 118/3519 (96.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 138 aa |
|---|---|
| Molecular weight | 15.7 kDa |
| Theoretical pI | 11.16 |
| GRAVY | -0.598 (hydrophilic) |
| Aliphatic index | 82.0 |
| Aromaticity | 0.072 |
| Instability index | 29.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_L16 | PF00252.25 | 5.8e-52 | 4–132 | Ribosomal protein L16p/L10e |
Experimental structures (Protein Data Bank) 11 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7sfr |
Electron Microscopy | 2.6 Å | 100% |
7kgb |
Electron Microscopy | 2.7 Å | 100% |
7mt7 |
Electron Microscopy | 2.71 Å | 100% |
7mt2 |
Electron Microscopy | 2.76 Å | 100% |
7msm |
Electron Microscopy | 2.79 Å | 100% |
7mt3 |
Electron Microscopy | 2.8 Å | 100% |
7msc |
Electron Microscopy | 2.97 Å | 100% |
7msz |
Electron Microscopy | 3.1 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (11 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5xym-assembly1_M |
1.00 | 0.99 | 2.1e-23 sig | 5xym-assembly1_M Large subunit of Mycobacterium smegmatis |
5zeb-assembly1_N |
1.00 | 0.99 | 1.2e-22 sig | 5zeb-assembly1_N M. Smegmatis P/P state 70S ribosome structure |
8cvm-assembly1_l |
1.00 | 0.98 | 9.6e-23 sig | 8cvm-assembly1_l Cutibacterium acnes 50S ribosomal subunit with P-site tRNA and Sarecycline bound in the local refined map |
5v93-assembly1_M |
1.00 | 0.97 | 6.9e-22 sig | 5v93-assembly1_M Cryo-EM structure of the 70S ribosome from Mycobacterium tuberculosis bound with Capreomycin |
8qcq-assembly1_M |
1.00 | 0.98 | 2.8e-19 sig | 8qcq-assembly1_M B. subtilis ApdA-stalled ribosomal complex |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 7
| Upstream (5' on genome) | rpsC (+ strand, 3 bp gap) |
|---|---|
| Downstream (3' on genome) | rpmC (+ strand, -1 bp gap) |
| Predicted operon |
rplB · rpsS · rplV · rpsC · rplP · rpmC · rpsQ
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv0324 (represses) · Rv1049 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rpsD (30S ribosomal protein S4), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3458c rpsD exp |
30S ribosomal protein S4 | 999 | 1000 ctx | cooccurence:496 coexpression:865 experimental:999 |
Rv0703 rplW exp |
50S ribosomal protein L23 | 999 | 1000 ctx | neighborhood:739 coexpression:968 experimental:999 database:652 textmining:528 |
Rv0683 rpsG exp |
30S ribosomal protein S7 | 999 | 1000 ctx | cooccurence:705 coexpression:861 experimental:999 |
Rv0718 rpsH exp |
30S ribosomal protein S8 | 999 | 1000 ctx | cooccurence:606 coexpression:963 experimental:999 |
Rv2904c rplS exp |
50S ribosomal protein L19 | 999 | 1000 | coexpression:810 experimental:999 textmining:604 |
Rv0055 rpsR1 exp |
30S ribosomal protein S18 | 999 | 1000 | coexpression:734 experimental:999 |
Rv0704 rplB exp |
50S ribosomal protein L2 | 999 | 1000 ctx | neighborhood:822 cooccurence:734 coexpression:995 experimental:999 database:497 textmining:693 |
Rv0705 rpsS exp |
30S ribosomal protein S19 | 999 | 1000 ctx | neighborhood:882 cooccurence:752 coexpression:996 experimental:999 textmining:619 |
Rv0053 rpsF exp |
30S ribosomal protein S6 | 999 | 1000 | coexpression:861 experimental:999 |
Rv0710 rpsQ exp |
30S ribosomal protein S17 | 999 | 1000 ctx | neighborhood:882 cooccurence:424 coexpression:975 experimental:999 textmining:625 |
Rv0715 rplX exp |
50S ribosomal protein L24 | 999 | 1000 | coexpression:882 experimental:999 database:516 textmining:430 |
Rv2785c rpsO exp |
30S ribosomal protein S15 | 999 | 1000 ctx | cooccurence:414 coexpression:863 experimental:999 |
Rv0716 rplE exp |
50S ribosomal protein L5 | 999 | 1000 ctx | cooccurence:609 coexpression:886 experimental:999 database:461 textmining:702 |
Rv3461c rpmJ exp |
50S ribosomal protein L36 | 999 | 1000 | coexpression:865 experimental:999 |
Rv0709 rpmC exp |
50S ribosomal protein L29 | 999 | 1000 ctx | neighborhood:882 coexpression:987 experimental:999 database:461 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 50S ribosomal protein L16
- MTBC0 PGAP product: 50S ribosomal protein L16
- Pfam (hmmscan --cut_ga): Ribosomal_L16 PF00252.25 (E=6e-52)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215222.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L16 (PF00252.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0197 - Curated reference: UniProt P9WHD5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
278 functional partner(s); context anchor
rpsD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000750|Rv0708|rplP MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLFELSYPNEGVARAALTRAIHKLPIKARIITREEQF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rplP? Email the maintainer — the message is pre-filled with this gene's details.