rpmJ Resolved · high auto-curated
H37Rv Rv3461c · MTBC0 mtbc0_003679 ·
37 aa · 3906226–3906339 (-) ·
RefSeq NP_217978.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 50S ribosomal protein L36 |
|---|---|
| MTBC0 PGAP re-annotation | 50S ribosomal protein L36 |
| Revised (this work) | 50S ribosomal protein L36. Pfam: Ribosomal_L36 (PF00444.24). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WH89
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Large ribosomal subunit protein bL36 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpmJ |
| eggNOG description | Belongs to the bacterial ribosomal protein bL36 family |
| Orthologous group | COG0257 |
| KEGG orthology |
K02919
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_L36 | PF00444.24 | 3.3e-20 | 1–37 | Ribosomal protein L36 |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2442c rplU |
50S ribosomal protein L21 | 999 | 1000 | coexpression:858 experimental:999 |
Rv0707 rpsC |
30S ribosomal protein S3 | 999 | 1000 | coexpression:861 experimental:999 |
Rv0722 rpmD |
50S ribosomal protein L30 | 999 | 1000 | coexpression:858 experimental:999 textmining:490 |
Rv0056 rplI |
50S ribosomal protein L9 | 999 | 1000 | coexpression:652 experimental:999 |
Rv0719 rplF |
50S ribosomal protein L6 | 999 | 1000 | coexpression:867 experimental:999 |
Rv3443c rplM |
50S ribosomal protein L13 | 999 | 1000 | coexpression:861 experimental:999 |
Rv0702 rplD |
50S ribosomal protein L4 | 999 | 1000 | coexpression:884 experimental:999 |
Rv3456c rplQ |
50S ribosomal protein L17 | 999 | 1000 | coexpression:910 experimental:999 |
Rv0720 rplR |
50S ribosomal protein L18 | 999 | 1000 | coexpression:859 experimental:999 |
Rv2441c rpmA |
50S ribosomal protein L27 | 999 | 1000 | coexpression:804 experimental:999 |
Rv1298 rpmE |
50S ribosomal protein L31 | 999 | 1000 | coexpression:734 experimental:999 textmining:700 |
Rv1015c rplY |
50S ribosomal protein L25/general stress protein Ctc | 999 | 1000 | coexpression:715 experimental:999 |
Rv0634B rpmG2 |
50S ribosomal protein L33 | 999 | 1000 | coexpression:670 experimental:999 textmining:593 |
Rv0682 rpsL |
30S ribosomal protein S12 | 999 | 1000 | coexpression:968 experimental:999 |
Rv0717 rpsN1 |
30S ribosomal protein S14 | 999 | 1000 | coexpression:734 experimental:999 textmining:697 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 50S ribosomal protein L36
- MTBC0 PGAP product: 50S ribosomal protein L36
- Pfam (hmmscan --cut_ga): Ribosomal_L36 PF00444.24 (E=3e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217978.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L36 (PF00444.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0257 - Curated reference: UniProt P9WH89 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 237 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003679|Rv3461c|rpmJ MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG