rpmJ Resolved · high auto-curated

H37Rv Rv3461c · MTBC0 mtbc0_003679 · 37 aa · 3906226–3906339 (-) · RefSeq NP_217978.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L36
MTBC0 PGAP re-annotation50S ribosomal protein L36
Revised (this work)50S ribosomal protein L36. Pfam: Ribosomal_L36 (PF00444.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH89 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL36

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmJ
eggNOG descriptionBelongs to the bacterial ribosomal protein bL36 family
Orthologous groupCOG0257
KEGG orthology K02919
KEGG pathways map03010
KEGG modules M00178

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L36PF00444.24 3.3e-201–37 Ribosomal protein L36

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:858 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:861 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:858 experimental:999 textmining:490
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:652 experimental:999
Rv0719 rplF 50S ribosomal protein L6 999 1000 coexpression:867 experimental:999
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:861 experimental:999
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:884 experimental:999
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:910 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:859 experimental:999
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:804 experimental:999
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:734 experimental:999 textmining:700
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:715 experimental:999
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:670 experimental:999 textmining:593
Rv0682 rpsL 30S ribosomal protein S12 999 1000 coexpression:968 experimental:999
Rv0717 rpsN1 30S ribosomal protein S14 999 1000 coexpression:734 experimental:999 textmining:697

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L36
  • MTBC0 PGAP product: 50S ribosomal protein L36
  • Pfam (hmmscan --cut_ga): Ribosomal_L36 PF00444.24 (E=3e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217978.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L36 (PF00444.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0257
  • Curated reference: UniProt P9WH89 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 237 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003679|Rv3461c|rpmJ
MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG