rplI Resolved · high auto-curated

H37Rv Rv0056 · MTBC0 mtbc0_000061 · 152 aa · 59517–59975 (+) · RefSeq NP_214570.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L9
MTBC0 PGAP re-annotation50S ribosomal protein L9
Revised (this work)50S ribosomal protein L9. Pfam: Ribosomal_L9_N (PF01281.26), Ribosomal_L9_C (PF03948.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH79 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL9
Curated functionBinds to 23S rRNA. In this organism 23S rRNA helices H15 and H16a are extended and form a 'kissing loop'; bL9 binds to H15 via both its N- and C-termini.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplI
eggNOG descriptionbinds to the 23S rRNA
Orthologous groupCOG0359
KEGG orthology K02939
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (59) GO:0003674, GO:0003676, GO:0003723, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886 +47 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.232 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L9_NPF01281.26 4.0e-201–46 Ribosomal protein L9, N-terminal domain
Ribosomal_L9_CPF03948.20 4.4e-2363–150 Ribosomal protein L9, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsR1 (30S ribosomal protein S18), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:854 experimental:999
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 ctx neighborhood:833 coexpression:790 experimental:999 textmining:826
Rv0704 rplB 50S ribosomal protein L2 999 1000 coexpression:864 experimental:999
Rv0718 rpsH 30S ribosomal protein S8 999 1000 coexpression:864 experimental:999
Rv0053 rpsF 30S ribosomal protein S6 999 1000 ctx neighborhood:708 coexpression:866 experimental:999 textmining:466
Rv0708 rplP 50S ribosomal protein L16 999 1000 coexpression:856 experimental:999 textmining:430
Rv0705 rpsS 30S ribosomal protein S19 999 1000 coexpression:859 experimental:999
Rv3458c rpsD 30S ribosomal protein S4 999 1000 coexpression:861 experimental:999
Rv0703 rplW 50S ribosomal protein L23 999 1000 coexpression:859 experimental:999
Rv0683 rpsG 30S ribosomal protein S7 999 1000 coexpression:837 experimental:999
Rv0714 rplN 50S ribosomal protein L14 999 1000 coexpression:775 experimental:999
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:822 experimental:999
Rv0701 rplC 50S ribosomal protein L3 999 1000 coexpression:861 experimental:999
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:651 experimental:999
Rv3460c rpsM 30S ribosomal protein S13 999 1000 coexpression:692 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L9
  • MTBC0 PGAP product: 50S ribosomal protein L9
  • Pfam (hmmscan --cut_ga): Ribosomal_L9_N PF01281.26 (E=4e-20), Ribosomal_L9_C PF03948.20 (E=4e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214570.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L9_N (PF01281.26), Ribosomal_L9_C (PF03948.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0359
  • Curated reference: UniProt P9WH79 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 200 functional partner(s); context anchor rpsR1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000061|Rv0056|rplI
MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQKQADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAIKKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS