rpsJ Resolved · high auto-curated

H37Rv Rv0700 · MTBC0 - · 101 aa · 800487–800792 (+) · RefSeq NP_215214.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S10
MTBC0 PGAP re-annotation
Revised (this work)30S ribosomal protein S10. Pfam: Ribosomal_S10 (PF00338.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH67 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS10
Curated functionInvolved in the binding of tRNA to the ribosomes.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsJ
eggNOG descriptionInvolved in the binding of tRNA to the ribosomes
Orthologous groupCOG0051
KEGG orthology K02946
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (54) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006412 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S10PF00338.28 3.8e-367–100 Ribosomal protein S10p/S20e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplC (50S ribosomal protein L3), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:861 experimental:999 database:844
Rv0701 rplC 50S ribosomal protein L3 999 1000 ctx neighborhood:861 coexpression:985 experimental:999 textmining:591
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:871 experimental:999
Rv3460c rpsM 30S ribosomal protein S13 999 1000 ctx cooccurence:452 coexpression:943 experimental:999 database:662 textmining:583
Rv0714 rplN 50S ribosomal protein L14 999 1000 ctx cooccurence:445 coexpression:979 experimental:999 textmining:734
Rv0709 rpmC 50S ribosomal protein L29 999 1000 ctx neighborhood:728 coexpression:898 experimental:999
Rv0721 rpsE 30S ribosomal protein S5 999 1000 ctx cooccurence:584 coexpression:886 experimental:999 database:844 textmining:601
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:888 experimental:999
Rv2785c rpsO 30S ribosomal protein S15 999 1000 coexpression:853 experimental:999 database:844
Rv0716 rplE 50S ribosomal protein L5 999 1000 ctx cooccurence:631 coexpression:967 experimental:999 textmining:591
Rv0715 rplX 50S ribosomal protein L24 999 1000 coexpression:979 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 ctx neighborhood:728 coexpression:865 experimental:999 database:844 textmining:406
Rv2412 rpsT 30S ribosomal protein S20 999 1000 coexpression:803 experimental:999
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:860 experimental:999 database:844 textmining:440
Rv0708 rplP 50S ribosomal protein L16 999 1000 ctx neighborhood:728 coexpression:929 experimental:999 textmining:609

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 30S ribosomal protein S10
  • Pfam (hmmscan --cut_ga): Ribosomal_S10 PF00338.28 (E=4e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215214.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S10 (PF00338.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0051
  • Curated reference: UniProt P9WH67 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 274 functional partner(s); context anchor rplC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0700|rpsJ
MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYCVIRSPHKYKDSREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ