rplF Resolved · high auto-curated

H37Rv Rv0719 · MTBC0 - · 179 aa · 813398–813937 (+) · RefSeq NP_215233.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L6
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L6. Pfam: Ribosomal_L6 (PF00347.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH81 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL6
Curated functionThis protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplF
eggNOG descriptionThis protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7 L12 stalk, and near the tRNA binding site of the peptidyltransferase center
Orthologous groupCOG0097
KEGG orthology K02933
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (63) GO:0002181, GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737 +51 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.172 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L6PF00347.29 7.1e-2591–165 Ribosomal protein L6

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplB (50S ribosomal protein L2), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3458c rpsD 30S ribosomal protein S4 999 1000 coexpression:892 experimental:999
Rv0703 rplW 50S ribosomal protein L23 999 1000 coexpression:973 experimental:999 database:687
Rv0683 rpsG 30S ribosomal protein S7 999 1000 coexpression:889 experimental:999
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:834 experimental:999 textmining:593
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 coexpression:733 experimental:999 textmining:494
Rv0704 rplB 50S ribosomal protein L2 999 1000 ctx cooccurence:678 coexpression:976 experimental:999 database:532 textmining:816
Rv0718 rpsH 30S ribosomal protein S8 999 1000 ctx neighborhood:847 fusion:698 cooccurence:600 coexpression:976 experimental:999 textmining:431
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:863 experimental:999 textmining:522
Rv0708 rplP 50S ribosomal protein L16 999 1000 ctx cooccurence:636 coexpression:968 experimental:999 database:636 textmining:619
Rv0705 rpsS 30S ribosomal protein S19 999 1000 ctx cooccurence:671 coexpression:971 experimental:999 textmining:606
Rv2785c rpsO 30S ribosomal protein S15 999 1000 coexpression:861 experimental:999
Rv0716 rplE 50S ribosomal protein L5 999 1000 ctx neighborhood:727 cooccurence:748 coexpression:966 experimental:999 database:571 textmining:719
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:867 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 ctx cooccurence:436 coexpression:918 experimental:999 textmining:429
Rv0715 rplX 50S ribosomal protein L24 999 1000 ctx neighborhood:727 coexpression:971 experimental:999 database:715

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L6
  • Pfam (hmmscan --cut_ga): Ribosomal_L6 PF00347.29 (E=7e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215233.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L6 (PF00347.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0097
  • Curated reference: UniProt P9WH81 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 331 functional partner(s); context anchor rplB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0719|rplF
MSRIGKQPIPVPAGVDVTIEGQSISVKGPKGTLGLTVAEPIKVARNDDGAIVVTRPDDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIRRLRRPDPYKGKGVRYEGEQIRRKVGKTGK