rpsK Resolved · high auto-curated
H37Rv Rv3459c · MTBC0 mtbc0_003677 ·
139 aa ·
3905156–3905575 MTBC0
(-) ·
RefSeq NP_217976.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S11 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S11 |
| Revised (this work) | 30S ribosomal protein S11. Pfam: Ribosomal_S11 (PF00411.25). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Overproduction of mycobacterial ribosomal protein S13 induces catalase/peroxidase activity and hypersensitivity to isoniazid in Mycobacterium smegmatis. doi:10.1016/0378-1119(95)00841-1 | 1996 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 33% of residues (metapredict) · mean AlphaFold pLDDT 87.6 |
|---|---|
| Disordered regions | 2 IDR(s), longest 27 aa [0-27, 119-139] |
carries a substantial disordered region (47/139 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB1 (whiB1).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -11.73 (95% CI -14.20 to -9.33). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | S11 plays an essential role for the selection of the correct tRNA in protein biosynthesis. It is located on the large lobe of the small subunit. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3488c
· 99.3% identity |
|---|---|
| M. leprae |
ML1959c
· 89.9% identity |
| M. marinum |
MMAR_1088
· 94.2% identity |
| M. smegmatis |
MSMEG_1522
· 92.1% identity |
| M. orygis |
RJtmp_003567
· 99.3% identity |
| M. abscessus |
MAB_3772c
· 89.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WH65
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Small ribosomal subunit protein uS11 |
| Curated function | Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsK |
| eggNOG description | Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome |
| Orthologous group | COG0100 |
| KEGG orthology |
K02948
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178, M00179
|
| Gene Ontology (93) |
GO:0000028, GO:0000462, GO:0003674, GO:0003676, GO:0003723, GO:0003729, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623 +81 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.528 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 94.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 78.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | Uncertain · uncertain |
|---|---|
| What the call means | uncertain (short or TA-poor ORF): no call possible |
| TA sites (Himar1) | 3 in the ORF — 2 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.333, mean read count 28. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 961.0 ppm · rank 236/3519 (93.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 139 aa |
|---|---|
| Molecular weight | 14.8 kDa |
| Theoretical pI | 11.69 |
| GRAVY | -0.709 (hydrophilic) |
| Aliphatic index | 63.2 |
| Aromaticity | 0.036 |
| Instability index | 45.4 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S11 | PF00411.25 | 1.2e-48 | 29–138 | Ribosomal protein S11 |
Experimental structures (Protein Data Bank) 10 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7sfr |
Electron Microscopy | 2.6 Å | 100% |
7kgb |
Electron Microscopy | 2.7 Å | 100% |
7mt7 |
Electron Microscopy | 2.71 Å | 100% |
7mt2 |
Electron Microscopy | 2.76 Å | 100% |
7msm |
Electron Microscopy | 2.79 Å | 100% |
7mt3 |
Electron Microscopy | 2.8 Å | 100% |
7msc |
Electron Microscopy | 2.97 Å | 100% |
7msz |
Electron Microscopy | 3.1 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (10 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5xyu-assembly1_K |
1.00 | 0.98 | 2.9e-20 sig | 5xyu-assembly1_K Small subunit of Mycobacterium smegmatis ribosome |
8buu-assembly1_k |
1.00 | 0.98 | 8.8e-19 sig | 8buu-assembly1_k ARE-ABCF VmlR2 bound to a 70S ribosome |
7p7t-assembly1_l |
1.00 | 0.98 | 9.4e-19 sig | 7p7t-assembly1_l PoxtA-EQ2 antibiotic resistance ABCF bound to E. faecalis 70S ribosome, state III |
8cwo-assembly1_K |
1.00 | 0.98 | 1.4e-18 sig | 8cwo-assembly1_K Cutibacterium acnes 30S ribosomal subunit with Sarecycline bound, body domain only in the local refined map |
7p7q-assembly1_l |
1.00 | 0.98 | 1.8e-17 sig | 7p7q-assembly1_l E. faecalis 70S ribosome bound by PoxtA-EQ2, high-resolution combined volume |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | rpsD (- strand, 8 bp gap) |
|---|---|
| Downstream (3' on genome) | rpsM (- strand, 3 bp gap) |
| Predicted operon |
rpsD · rpsK · rpsM
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: rplF (50S ribosomal protein L6), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3443c rplM exp |
50S ribosomal protein L13 | 999 | 1000 | coexpression:863 experimental:999 textmining:672 |
Rv0719 rplF exp |
50S ribosomal protein L6 | 999 | 1000 ctx | cooccurence:514 coexpression:879 experimental:999 textmining:591 |
Rv0702 rplD exp |
50S ribosomal protein L4 | 999 | 1000 | coexpression:929 experimental:999 database:844 textmining:689 |
Rv3456c rplQ exp |
50S ribosomal protein L17 | 999 | 1000 ctx | neighborhood:726 coexpression:936 experimental:999 textmining:622 |
Rv0707 rpsC exp |
30S ribosomal protein S3 | 999 | 1000 ctx | cooccurence:735 coexpression:864 experimental:999 database:925 textmining:592 |
Rv2442c rplU exp |
50S ribosomal protein L21 | 999 | 1000 | coexpression:863 experimental:999 |
Rv0722 rpmD exp |
50S ribosomal protein L30 | 999 | 1000 | coexpression:863 experimental:999 |
Rv0056 rplI exp |
50S ribosomal protein L9 | 999 | 1000 | coexpression:852 experimental:999 |
Rv1015c rplY exp |
50S ribosomal protein L25/general stress protein Ctc | 999 | 1000 | coexpression:742 experimental:999 |
Rv0634B rpmG2 exp |
50S ribosomal protein L33 | 999 | 1000 | coexpression:729 experimental:999 |
Rv0720 rplR exp |
50S ribosomal protein L18 | 999 | 1000 ctx | cooccurence:500 coexpression:865 experimental:999 textmining:480 |
Rv2441c rpmA exp |
50S ribosomal protein L27 | 999 | 1000 | coexpression:824 experimental:999 textmining:588 |
Rv1298 rpmE exp |
50S ribosomal protein L31 | 999 | 1000 | coexpression:538 experimental:999 |
Rv3462c infA exp |
translation initiation factor IF-1 | 999 | 1000 ctx | neighborhood:547 cooccurence:653 coexpression:923 experimental:928 database:547 textmining:452 |
Rv3442c rpsI exp |
30S ribosomal protein S9 | 999 | 1000 | coexpression:820 experimental:999 database:925 textmining:579 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S11
- MTBC0 PGAP product: 30S ribosomal protein S11
- Pfam (hmmscan --cut_ga): Ribosomal_S11 PF00411.25 (E=1e-48)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217976.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S11 (PF00411.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0100 - Curated reference: UniProt P9WH65 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
275 functional partner(s); context anchor
rplF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003677|Rv3459c|rpsK MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for rpsK? Email the maintainer — the message is pre-filled with this gene's details.