rpsK Resolved · high auto-curated

H37Rv Rv3459c · MTBC0 mtbc0_003677 · 139 aa · 3905156–3905575 (-) · RefSeq NP_217976.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S11
MTBC0 PGAP re-annotation30S ribosomal protein S11
Revised (this work)30S ribosomal protein S11. Pfam: Ribosomal_S11 (PF00411.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH65 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS11
Curated functionLocated on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsK
eggNOG descriptionLocated on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome
Orthologous groupCOG0100
KEGG orthology K02948
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (93) GO:0000028, GO:0000462, GO:0003674, GO:0003676, GO:0003723, GO:0003729, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623 +81 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.528 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S11PF00411.25 1.2e-4829–138 Ribosomal protein S11

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplF (50S ribosomal protein L6), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:863 experimental:999 textmining:672
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx cooccurence:514 coexpression:879 experimental:999 textmining:591
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:929 experimental:999 database:844 textmining:689
Rv3456c rplQ 50S ribosomal protein L17 999 1000 ctx neighborhood:726 coexpression:936 experimental:999 textmining:622
Rv0707 rpsC 30S ribosomal protein S3 999 1000 ctx cooccurence:735 coexpression:864 experimental:999 database:925 textmining:592
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:863 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:863 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:852 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:742 experimental:999
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:729 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 ctx cooccurence:500 coexpression:865 experimental:999 textmining:480
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:824 experimental:999 textmining:588
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:538 experimental:999
Rv3462c infA translation initiation factor IF-1 999 1000 ctx neighborhood:547 cooccurence:653 coexpression:923 experimental:928 database:547 textmining:452
Rv3442c rpsI 30S ribosomal protein S9 999 1000 coexpression:820 experimental:999 database:925 textmining:579

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S11
  • MTBC0 PGAP product: 30S ribosomal protein S11
  • Pfam (hmmscan --cut_ga): Ribosomal_S11 PF00411.25 (E=1e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217976.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S11 (PF00411.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0100
  • Curated reference: UniProt P9WH65 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 275 functional partner(s); context anchor rplF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003677|Rv3459c|rpsK
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV