rplV Resolved · high auto-curated

H37Rv Rv0706 · MTBC0 mtbc0_000748 · 197 aa · 807882–808475 (+) · RefSeq NP_215220.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L22
MTBC0 PGAP re-annotation50S ribosomal protein L22
Revised (this work)50S ribosomal protein L22. Pfam: Ribosomal_L22 (PF00237.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHC1 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL22
Curated functionThis protein binds specifically to 23S rRNA; its binding is stimulated by other ribosomal proteins, e.g. L4, L17, and L20. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity)..; FUNCTION: The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplV
eggNOG descriptionThe globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome
Orthologous groupCOG0091
KEGG orthology K02890
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (30) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0008150, GO:0015934 +18 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.37 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L22PF00237.25 6.1e-3815–118 Ribosomal protein L22p/L17e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplB (50S ribosomal protein L2), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 coexpression:734 experimental:999
Rv0704 rplB 50S ribosomal protein L2 999 1000 ctx neighborhood:822 cooccurence:537 coexpression:995 experimental:999 database:639 textmining:856
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:866 experimental:999
Rv0718 rpsH 30S ribosomal protein S8 999 1000 ctx cooccurence:685 coexpression:968 experimental:999
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:860 experimental:999
Rv0705 rpsS 30S ribosomal protein S19 999 1000 ctx neighborhood:882 cooccurence:612 coexpression:995 experimental:999
Rv0708 rplP 50S ribosomal protein L16 999 1000 ctx neighborhood:882 cooccurence:500 coexpression:995 experimental:999 database:651 textmining:634
Rv0703 rplW 50S ribosomal protein L23 999 1000 ctx neighborhood:739 coexpression:990 experimental:999 database:844 textmining:718
Rv3458c rpsD 30S ribosomal protein S4 999 1000 ctx cooccurence:612 coexpression:892 experimental:999
Rv0683 rpsG 30S ribosomal protein S7 999 1000 coexpression:865 experimental:999 textmining:887
Rv0714 rplN 50S ribosomal protein L14 999 1000 ctx cooccurence:402 coexpression:880 experimental:999 database:654
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:894 experimental:999
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:862 experimental:999
Rv0701 rplC 50S ribosomal protein L3 999 1000 ctx neighborhood:739 cooccurence:519 coexpression:958 experimental:999 database:749 textmining:850
Rv3460c rpsM 30S ribosomal protein S13 999 1000 ctx cooccurence:609 coexpression:785 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L22
  • MTBC0 PGAP product: 50S ribosomal protein L22
  • Pfam (hmmscan --cut_ga): Ribosomal_L22 PF00237.25 (E=6e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215220.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L22 (PF00237.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0091
  • Curated reference: UniProt P9WHC1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 274 functional partner(s); context anchor rplB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000748|Rv0706|rplV
MTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVESRPAKDQRSAKSSRARRTEASKAASKVGATAPAKKAAAKAPAKKAPASSGVKKTPAKKAPAKKAPAKASETSAAKGGSD