rpsL Resolved · high auto-curated

H37Rv Rv0682 · MTBC0 mtbc0_000721 · 124 aa · 785646–786020 (+) · RefSeq NP_215196.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S12
MTBC0 PGAP re-annotation30S ribosomal protein S12
Revised (this work)30S ribosomal protein S12. Pfam: Ribosom_S12_S23 (PF00164.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH63 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS12
Curated functionWith S4 and S5 plays an important role in translational accuracy..; FUNCTION: Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsL
eggNOG descriptionInteracts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit
Orthologous groupCOG0048
KEGG orthology K02950
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (44) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005840, GO:0006412, GO:0006518, GO:0006807, GO:0008150 +32 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.335 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosom_S12_S23PF00164.32 3.9e-4118–123 Ribosomal protein S12/S23

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsK (30S ribosomal protein S11), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0717 rpsN1 30S ribosomal protein S14 999 1000 coexpression:734 experimental:999 database:662
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:861 experimental:999
Rv3442c rpsI 30S ribosomal protein S9 999 1000 coexpression:861 experimental:999 database:844 textmining:516
Rv0700 rpsJ 30S ribosomal protein S10 999 1000 coexpression:967 experimental:999 database:844 textmining:614
Rv0706 rplV 50S ribosomal protein L22 999 1000 coexpression:888 experimental:999
Rv3459c rpsK 30S ribosomal protein S11 999 1000 ctx cooccurence:512 coexpression:968 experimental:999 database:844
Rv0723 rplO 50S ribosomal protein L15 999 1000 coexpression:865 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:864 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 ctx cooccurence:473 coexpression:864 experimental:999 database:844 textmining:512
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:863 experimental:999 textmining:451
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:794 experimental:999
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:958 experimental:999 database:844
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx cooccurence:422 coexpression:905 experimental:999
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:863 experimental:999 textmining:625
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:946 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S12
  • MTBC0 PGAP product: 30S ribosomal protein S12
  • Pfam (hmmscan --cut_ga): Ribosom_S12_S23 PF00164.32 (E=4e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215196.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosom_S12_S23 (PF00164.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0048
  • Curated reference: UniProt P9WH63 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 308 functional partner(s); context anchor rpsK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000721|Rv0682|rpsL
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG