rpsS Resolved · high auto-curated
H37Rv Rv0705 · MTBC0 mtbc0_000747 ·
93 aa · 807604–807885 (+) ·
RefSeq NP_215219.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S19 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S19 |
| Revised (this work) | 30S ribosomal protein S19. Pfam: Ribosomal_S19 (PF00203.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WH45
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Small ribosomal subunit protein uS19 |
| Curated function | Protein uS19 forms a complex with uS13 that binds strongly to the 16S ribosomal RNA. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsS |
| eggNOG description | Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA |
| Orthologous group | COG0185 |
| KEGG orthology |
K02965
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178, M00179
|
| Gene Ontology (47) |
GO:0000028, GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006996 +35 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S19 | PF00203.27 | 8.4e-39 | 3–83 | Ribosomal protein S19 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rpsH (30S ribosomal protein S8), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0718 rpsH |
30S ribosomal protein S8 | 999 | 1000 ctx | cooccurence:690 coexpression:969 experimental:999 database:925 |
Rv2904c rplS |
50S ribosomal protein L19 | 999 | 1000 | coexpression:775 experimental:999 textmining:601 |
Rv0704 rplB |
50S ribosomal protein L2 | 999 | 1000 ctx | neighborhood:822 cooccurence:765 coexpression:995 experimental:999 textmining:621 |
Rv0055 rpsR1 |
30S ribosomal protein S18 | 999 | 1000 | coexpression:733 experimental:999 database:540 |
Rv0708 rplP |
50S ribosomal protein L16 | 999 | 1000 ctx | neighborhood:882 cooccurence:752 coexpression:996 experimental:999 textmining:619 |
Rv0053 rpsF |
30S ribosomal protein S6 | 999 | 1000 | coexpression:860 experimental:999 |
Rv3458c rpsD |
30S ribosomal protein S4 | 999 | 1000 | coexpression:888 experimental:999 database:844 |
Rv0703 rplW |
50S ribosomal protein L23 | 999 | 1000 ctx | neighborhood:739 coexpression:995 experimental:999 textmining:823 |
Rv0683 rpsG |
30S ribosomal protein S7 | 999 | 1000 ctx | cooccurence:536 coexpression:864 experimental:999 database:925 |
Rv0714 rplN |
50S ribosomal protein L14 | 999 | 1000 ctx | cooccurence:694 coexpression:884 experimental:999 textmining:610 |
Rv3460c rpsM |
30S ribosomal protein S13 | 999 | 1000 ctx | cooccurence:727 coexpression:804 experimental:999 database:662 textmining:590 |
Rv1642 rpmI |
50S ribosomal protein L35 | 999 | 1000 | coexpression:883 experimental:999 |
Rv0701 rplC |
50S ribosomal protein L3 | 999 | 1000 ctx | neighborhood:739 cooccurence:529 coexpression:960 experimental:999 textmining:590 |
Rv2909c rpsP |
30S ribosomal protein S16 | 999 | 1000 | coexpression:830 experimental:999 |
Rv0710 rpsQ |
30S ribosomal protein S17 | 999 | 1000 ctx | neighborhood:882 coexpression:967 experimental:999 database:925 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S19
- MTBC0 PGAP product: 30S ribosomal protein S19
- Pfam (hmmscan --cut_ga): Ribosomal_S19 PF00203.27 (E=8e-39)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215219.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S19 (PF00203.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0185 - Curated reference: UniProt P9WH45 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
190 functional partner(s); context anchor
rpsH - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000747|Rv0705|rpsS MPRSLKKGPFVDEHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR