rpsS Resolved · high auto-curated

H37Rv Rv0705 · MTBC0 mtbc0_000747 · 93 aa · 807604–807885 (+) · RefSeq NP_215219.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S19
MTBC0 PGAP re-annotation30S ribosomal protein S19
Revised (this work)30S ribosomal protein S19. Pfam: Ribosomal_S19 (PF00203.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH45 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS19
Curated functionProtein uS19 forms a complex with uS13 that binds strongly to the 16S ribosomal RNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsS
eggNOG descriptionProtein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA
Orthologous groupCOG0185
KEGG orthology K02965
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (47) GO:0000028, GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006996 +35 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S19PF00203.27 8.4e-393–83 Ribosomal protein S19

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpsH (30S ribosomal protein S8), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0718 rpsH 30S ribosomal protein S8 999 1000 ctx cooccurence:690 coexpression:969 experimental:999 database:925
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:775 experimental:999 textmining:601
Rv0704 rplB 50S ribosomal protein L2 999 1000 ctx neighborhood:822 cooccurence:765 coexpression:995 experimental:999 textmining:621
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 coexpression:733 experimental:999 database:540
Rv0708 rplP 50S ribosomal protein L16 999 1000 ctx neighborhood:882 cooccurence:752 coexpression:996 experimental:999 textmining:619
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:860 experimental:999
Rv3458c rpsD 30S ribosomal protein S4 999 1000 coexpression:888 experimental:999 database:844
Rv0703 rplW 50S ribosomal protein L23 999 1000 ctx neighborhood:739 coexpression:995 experimental:999 textmining:823
Rv0683 rpsG 30S ribosomal protein S7 999 1000 ctx cooccurence:536 coexpression:864 experimental:999 database:925
Rv0714 rplN 50S ribosomal protein L14 999 1000 ctx cooccurence:694 coexpression:884 experimental:999 textmining:610
Rv3460c rpsM 30S ribosomal protein S13 999 1000 ctx cooccurence:727 coexpression:804 experimental:999 database:662 textmining:590
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:883 experimental:999
Rv0701 rplC 50S ribosomal protein L3 999 1000 ctx neighborhood:739 cooccurence:529 coexpression:960 experimental:999 textmining:590
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:830 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 ctx neighborhood:882 coexpression:967 experimental:999 database:925

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S19
  • MTBC0 PGAP product: 30S ribosomal protein S19
  • Pfam (hmmscan --cut_ga): Ribosomal_S19 PF00203.27 (E=8e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215219.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S19 (PF00203.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0185
  • Curated reference: UniProt P9WH45 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 190 functional partner(s); context anchor rpsH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000747|Rv0705|rpsS
MPRSLKKGPFVDEHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR