rplE Resolved · high auto-curated

H37Rv Rv0716 · MTBC0 mtbc0_000758 · 187 aa · 816252–816815 (+) · RefSeq NP_215230.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L5
MTBC0 PGAP re-annotation50S ribosomal protein L5
Revised (this work)50S ribosomal protein L5. Pfam: Ribosomal_L5 (PF00281.25), Ribosomal_L5_C (PF00673.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH83 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL5
Curated functionThis is one of the proteins that bind and probably mediate the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplE
eggNOG descriptionThis is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits
Orthologous groupCOG0094
KEGG orthology K02931
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (76) GO:0000027, GO:0003674, GO:0003676, GO:0003723, GO:0003735, GO:0005198, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829 +64 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.327 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L5PF00281.25 1.1e-2631–87 Ribosomal protein L5
Ribosomal_L5_CPF00673.27 1.0e-3891–184 ribosomal L5P family C-terminus

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplB (50S ribosomal protein L2), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0055 rpsR1 30S ribosomal protein S18 999 1000 coexpression:733 experimental:999
Rv0704 rplB 50S ribosomal protein L2 999 1000 ctx cooccurence:748 coexpression:972 experimental:999 database:617 textmining:847
Rv2904c rplS 50S ribosomal protein L19 999 1000 coexpression:827 experimental:999 textmining:594
Rv0718 rpsH 30S ribosomal protein S8 999 1000 ctx neighborhood:746 cooccurence:749 coexpression:973 experimental:999 textmining:519
Rv0053 rpsF 30S ribosomal protein S6 999 1000 coexpression:864 experimental:999
Rv0708 rplP 50S ribosomal protein L16 999 1000 ctx cooccurence:609 coexpression:886 experimental:999 database:461 textmining:702
Rv0705 rpsS 30S ribosomal protein S19 999 1000 ctx cooccurence:732 coexpression:946 experimental:999 textmining:602
Rv0703 rplW 50S ribosomal protein L23 999 1000 coexpression:967 experimental:999 database:597 textmining:858
Rv3458c rpsD 30S ribosomal protein S4 999 1000 ctx cooccurence:607 coexpression:865 experimental:999
Rv0683 rpsG 30S ribosomal protein S7 999 1000 ctx cooccurence:423 coexpression:864 experimental:999
Rv0714 rplN 50S ribosomal protein L14 999 1000 ctx neighborhood:881 cooccurence:747 coexpression:981 experimental:999 database:638 textmining:777
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:860 experimental:999 textmining:579
Rv0701 rplC 50S ribosomal protein L3 999 1000 ctx cooccurence:663 coexpression:960 experimental:999 database:620 textmining:721
Rv1642 rpmI 50S ribosomal protein L35 999 1000 coexpression:836 experimental:999
Rv3460c rpsM 30S ribosomal protein S13 999 1000 ctx cooccurence:763 coexpression:755 experimental:999 textmining:592

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L5
  • MTBC0 PGAP product: 50S ribosomal protein L5
  • Pfam (hmmscan --cut_ga): Ribosomal_L5 PF00281.25 (E=1e-26), Ribosomal_L5_C PF00673.27 (E=1e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215230.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L5 (PF00281.25), Ribosomal_L5_C (PF00673.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0094
  • Curated reference: UniProt P9WH83 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 245 functional partner(s); context anchor rplB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000758|Rv0716|rplE
MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN