rplC Resolved · high auto-curated

H37Rv Rv0701 · MTBC0 mtbc0_000743 · 217 aa · 804894–805547 (+) · RefSeq NP_215215.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L3
MTBC0 PGAP re-annotation50S ribosomal protein L3
Revised (this work)50S ribosomal protein L3. Pfam: Ribosomal_L3 (PF00297.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH87 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL3
Curated functionOne of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplC
eggNOG descriptionOne of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit
Orthologous groupCOG0087
KEGG orthology K02906
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (13) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0008150, GO:0016020, GO:0040007, GO:0044424, GO:0044444, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.349 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L3PF00297.29 2.5e-1792–187 Ribosomal protein L3

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplF (50S ribosomal protein L6), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:793 experimental:999
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:734 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:891 experimental:999 database:758
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:886 experimental:999 textmining:588
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:708 experimental:999
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx cooccurence:615 coexpression:967 experimental:999 database:733 textmining:618
Rv3443c rplM 50S ribosomal protein L13 999 1000 ctx cooccurence:603 coexpression:885 experimental:999 database:685 textmining:598
Rv0702 rplD 50S ribosomal protein L4 999 1000 ctx neighborhood:882 cooccurence:717 coexpression:975 experimental:999 database:585 textmining:924
Rv3456c rplQ 50S ribosomal protein L17 999 1000 ctx cooccurence:574 coexpression:963 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:864 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 ctx neighborhood:739 coexpression:929 experimental:999 textmining:701
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:865 experimental:999 database:744
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:861 experimental:999
Rv0723 rplO 50S ribosomal protein L15 999 1000 ctx cooccurence:579 coexpression:911 experimental:999 database:758 textmining:582
Rv0700 rpsJ 30S ribosomal protein S10 999 1000 ctx neighborhood:861 coexpression:985 experimental:999 textmining:591

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L3
  • MTBC0 PGAP product: 50S ribosomal protein L3
  • Pfam (hmmscan --cut_ga): Ribosomal_L3 PF00297.29 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215215.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L3 (PF00297.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0087
  • Curated reference: UniProt P9WH87 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 369 functional partner(s); context anchor rplF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000743|Rv0701|rplC
MARKGILGTKLGMTQVFDESNRVVPVTVVKAGPNVVTRIRTPERDGYSAVQLAYGEISPRKVNKPLTGQYTAAGVNPRRYLAELRLDDSDAATEYQVGQELTAEIFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKGTRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGGLVMVRSAIKRGEK