rpsC Resolved · high auto-curated

H37Rv Rv0707 · MTBC0 mtbc0_000749 · 274 aa · 808475–809299 (+) · RefSeq NP_215221.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S3
MTBC0 PGAP re-annotation30S ribosomal protein S3
Revised (this work)30S ribosomal protein S3. Pfam: KH_2 (PF07650.24), Ribosomal_S3_C (PF00189.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH37 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein uS3
Curated functionBinds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsC
eggNOG descriptionBinds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation
Orthologous groupCOG0092
KEGG orthology K02982
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (58) GO:0002181, GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886 +46 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.04 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
KH_2PF07650.24 1.1e-1938–109 KH domain
Ribosomal_S3_CPF00189.26 1.0e-35119–202 Ribosomal protein S3, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplR (50S ribosomal protein L18), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:789 experimental:999
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:727 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 ctx cooccurence:540 coexpression:970 experimental:999
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:810 experimental:999 textmining:610
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:879 experimental:999 textmining:619
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx cooccurence:407 coexpression:967 experimental:999 textmining:602
Rv0702 rplD 50S ribosomal protein L4 999 1000 ctx neighborhood:739 coexpression:968 experimental:999 database:844 textmining:603
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:967 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:851 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:859 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:973 experimental:999
Rv0723 rplO 50S ribosomal protein L15 999 1000 coexpression:959 experimental:999
Rv2056c rpsN2 30S ribosomal protein S14 999 1000 coexpression:733 experimental:997 database:662
Rv3459c rpsK 30S ribosomal protein S11 999 1000 ctx cooccurence:735 coexpression:864 experimental:999 database:925 textmining:592
Rv0706 rplV 50S ribosomal protein L22 999 1000 ctx neighborhood:882 cooccurence:600 coexpression:992 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S3
  • MTBC0 PGAP product: 30S ribosomal protein S3
  • Pfam (hmmscan --cut_ga): KH_2 PF07650.24 (E=1e-19), Ribosomal_S3_C PF00189.26 (E=1e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215221.1)
  • Domains: Pfam-A via hmmscan --cut_ga — KH_2 (PF07650.24), Ribosomal_S3_C (PF00189.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0092
  • Curated reference: UniProt P9WH37 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 234 functional partner(s); context anchor rplR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000749|Rv0707|rpsC
MGQKINPHGFRLGITTDWKSRWYADKQYAEYVKEDVAIRRLLSSGLERAGIADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILEVKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGASGTTATGTDAGRAAGGEEAAPDAAAPVEAQSTES