Rv1049 Resolved · high auto-curated
H37Rv Rv1049 · MTBC0 mtbc0_001126 ·
148 aa · 1179725–1180171 (+) ·
RefSeq NP_215565.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional repressor |
|---|---|
| MTBC0 PGAP re-annotation | oxidation-sensing regulator MosR |
| Revised (this work) | Oxidation-sensing regulator MosR. Pfam: MarR_2 (PF12802.14), HTH_Crp_2 (PF13545.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y5H3
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable transcriptional repressor protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | MarR family |
| Orthologous group | COG1846 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MarR_2 | PF12802.14 | 1.8e-10 | 33–95 | MarR family |
HTH_Crp_2 | PF13545.13 | 2.0e-06 | 53–88 | Crp-like helix-turn-helix domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1050 (oxidoreductase), medium confidence from genomic context alone (score 639 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1167c |
transcriptional regulator | 731 | 731 | coexpression:731 |
Rv2912c |
TetR family HTH-type transcriptional regulator | 730 | 730 | coexpression:730 |
Rv1050 |
oxidoreductase | 638 | 639 ctx | neighborhood:626 |
Rv3833 |
AraC family transcriptional regulator | 584 | 506 | coexpression:490 |
Rv1048c hyp |
hypothetical protein | 570 | 483 ctx | neighborhood:469 |
Rv1189 sigI |
ECF RNA polymerase sigma factor SigI | 567 | 460 ctx | cooccurence:423 |
Rv3328c sigJ |
ECF RNA polymerase sigma factor SigJ | 509 | 431 | |
Rv3167c |
TetR family transcriptional regulator | 565 | 414 | |
Rv0767c |
HTH-type transcriptional regulator | 409 | 409 | coexpression:409 |
Rv1985c lysG |
HTH-type transcriptional regulator | 423 | 398 | |
Rv2034 |
ArsR family HTH-type transcriptional repressor | 458 | 298 | |
Rv1938 ephB |
epoxide hydrolase EphB | 468 | 188 | |
Rv1963c mce3R |
transcriptional repressor Mce3R | 405 | 152 | |
Rv0078 |
transcriptional regulator | 408 | 98 | |
Rv0678 mmpR5 hyp |
hypothetical protein | 811 | 80 | textmining:803 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional repressor
- MTBC0 PGAP product: oxidation-sensing regulator MosR
- Pfam (hmmscan --cut_ga): MarR_2 PF12802.14 (E=2e-10), HTH_Crp_2 PF13545.13 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215565.1)
- Domains: Pfam-A via hmmscan --cut_ga — MarR_2 (PF12802.14), HTH_Crp_2 (PF13545.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1846 - Curated reference: UniProt I6Y5H3 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
26 functional partner(s); context anchor
Rv1050 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001126|Rv1049| MGKGAAFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSAGIDLTMSELAARIGVERTTLTRNLEVMRRDGLVRVMAGADARCKRIELTAKGRAALQKAVPLWRGVQAEVTASVGDWPRVRRDIANLGQAAEACR