Rv1049 Resolved · high auto-curated

H37Rv Rv1049 · MTBC0 mtbc0_001126 · 148 aa · 1179725–1180171 (+) · RefSeq NP_215565.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional repressor
MTBC0 PGAP re-annotationoxidation-sensing regulator MosR
Revised (this work)Oxidation-sensing regulator MosR. Pfam: MarR_2 (PF12802.14), HTH_Crp_2 (PF13545.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y5H3 TrEMBL · unreviewed · Predicted
UniProt nameProbable transcriptional repressor protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionMarR family
Orthologous groupCOG1846

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MarR_2PF12802.14 1.8e-1033–95 MarR family
HTH_Crp_2PF13545.13 2.0e-0653–88 Crp-like helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1050 (oxidoreductase), medium confidence from genomic context alone (score 639 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1167c transcriptional regulator 731 731 coexpression:731
Rv2912c TetR family HTH-type transcriptional regulator 730 730 coexpression:730
Rv1050 oxidoreductase 638 639 ctx neighborhood:626
Rv3833 AraC family transcriptional regulator 584 506 coexpression:490
Rv1048c hyp hypothetical protein 570 483 ctx neighborhood:469
Rv1189 sigI ECF RNA polymerase sigma factor SigI 567 460 ctx cooccurence:423
Rv3328c sigJ ECF RNA polymerase sigma factor SigJ 509 431
Rv3167c TetR family transcriptional regulator 565 414
Rv0767c HTH-type transcriptional regulator 409 409 coexpression:409
Rv1985c lysG HTH-type transcriptional regulator 423 398
Rv2034 ArsR family HTH-type transcriptional repressor 458 298
Rv1938 ephB epoxide hydrolase EphB 468 188
Rv1963c mce3R transcriptional repressor Mce3R 405 152
Rv0078 transcriptional regulator 408 98
Rv0678 mmpR5 hyp hypothetical protein 811 80 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional repressor
  • MTBC0 PGAP product: oxidation-sensing regulator MosR
  • Pfam (hmmscan --cut_ga): MarR_2 PF12802.14 (E=2e-10), HTH_Crp_2 PF13545.13 (E=2e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215565.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MarR_2 (PF12802.14), HTH_Crp_2 (PF13545.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1846
  • Curated reference: UniProt I6Y5H3 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor Rv1050
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001126|Rv1049|
MGKGAAFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSEGSAGIDLTMSELAARIGVERTTLTRNLEVMRRDGLVRVMAGADARCKRIELTAKGRAALQKAVPLWRGVQAEVTASVGDWPRVRRDIANLGQAAEACR