rpsP Resolved · high auto-curated

H37Rv Rv2909c · MTBC0 mtbc0_003091 · 162 aa · 3237984–3238472 (-) · RefSeq NP_217425.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S16
MTBC0 PGAP re-annotation30S ribosomal protein S16
Revised (this work)30S ribosomal protein S16. Pfam: Ribosomal_S16 (PF00886.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH53 SwissProt · reviewed · Evidence at protein level
UniProt nameSmall ribosomal subunit protein bS16

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsP
eggNOG descriptionBelongs to the bacterial ribosomal protein bS16 family
Orthologous groupCOG0228
KEGG orthology K02959
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (50) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005840, GO:0005886, GO:0006412, GO:0006518, GO:0006807 +38 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.332 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S16PF00886.25 1.1e-229–67 Ribosomal protein S16

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplQ (50S ribosomal protein L17), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:696 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:850 experimental:999
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:859 experimental:999 textmining:653
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:887 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:826 experimental:999 textmining:657
Rv3456c rplQ 50S ribosomal protein L17 999 1000 ctx cooccurence:484 coexpression:861 experimental:999
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:863 experimental:999
Rv0719 rplF 50S ribosomal protein L6 999 1000 coexpression:864 experimental:999 textmining:732
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:963 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:822 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:844 experimental:999 textmining:734
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:886 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:851 experimental:999
Rv0723 rplO 50S ribosomal protein L15 999 1000 coexpression:863 experimental:999
Rv0700 rpsJ 30S ribosomal protein S10 999 1000 coexpression:861 experimental:999 database:844

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S16
  • MTBC0 PGAP product: 30S ribosomal protein S16
  • Pfam (hmmscan --cut_ga): Ribosomal_S16 PF00886.25 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217425.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S16 (PF00886.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0228
  • Curated reference: UniProt P9WH53 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 240 functional partner(s); context anchor rplQ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003091|Rv2909c|rpsP
MAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKPSKLEVFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPALGGEQAELTAES