rpsP Resolved · high auto-curated
H37Rv Rv2909c · MTBC0 mtbc0_003091 ·
162 aa · 3237984–3238472 (-) ·
RefSeq NP_217425.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 30S ribosomal protein S16 |
|---|---|
| MTBC0 PGAP re-annotation | 30S ribosomal protein S16 |
| Revised (this work) | 30S ribosomal protein S16. Pfam: Ribosomal_S16 (PF00886.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WH53
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Small ribosomal subunit protein bS16 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| Preferred name | rpsP |
| eggNOG description | Belongs to the bacterial ribosomal protein bS16 family |
| Orthologous group | COG0228 |
| KEGG orthology |
K02959
|
| KEGG pathways |
map03010
|
| KEGG modules |
M00178
|
| Gene Ontology (50) |
GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005840, GO:0005886, GO:0006412, GO:0006518, GO:0006807 +38 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.332 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Ribosomal_S16 | PF00886.25 | 1.1e-22 | 9–67 | Ribosomal protein S16 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: rplQ (50S ribosomal protein L17), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0634B rpmG2 |
50S ribosomal protein L33 | 999 | 1000 | coexpression:696 experimental:999 |
Rv1015c rplY |
50S ribosomal protein L25/general stress protein Ctc | 999 | 1000 | coexpression:850 experimental:999 |
Rv1298 rpmE |
50S ribosomal protein L31 | 999 | 1000 | coexpression:859 experimental:999 textmining:653 |
Rv2441c rpmA |
50S ribosomal protein L27 | 999 | 1000 | coexpression:887 experimental:999 |
Rv0720 rplR |
50S ribosomal protein L18 | 999 | 1000 | coexpression:826 experimental:999 textmining:657 |
Rv3456c rplQ |
50S ribosomal protein L17 | 999 | 1000 ctx | cooccurence:484 coexpression:861 experimental:999 |
Rv0702 rplD |
50S ribosomal protein L4 | 999 | 1000 | coexpression:863 experimental:999 |
Rv0719 rplF |
50S ribosomal protein L6 | 999 | 1000 | coexpression:864 experimental:999 textmining:732 |
Rv3443c rplM |
50S ribosomal protein L13 | 999 | 1000 | coexpression:963 experimental:999 |
Rv0056 rplI |
50S ribosomal protein L9 | 999 | 1000 | coexpression:822 experimental:999 |
Rv0722 rpmD |
50S ribosomal protein L30 | 999 | 1000 | coexpression:844 experimental:999 textmining:734 |
Rv2442c rplU |
50S ribosomal protein L21 | 999 | 1000 | coexpression:886 experimental:999 |
Rv0707 rpsC |
30S ribosomal protein S3 | 999 | 1000 | coexpression:851 experimental:999 |
Rv0723 rplO |
50S ribosomal protein L15 | 999 | 1000 | coexpression:863 experimental:999 |
Rv0700 rpsJ |
30S ribosomal protein S10 | 999 | 1000 | coexpression:861 experimental:999 database:844 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 30S ribosomal protein S16
- MTBC0 PGAP product: 30S ribosomal protein S16
- Pfam (hmmscan --cut_ga): Ribosomal_S16 PF00886.25 (E=1e-22)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217425.1)
- Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S16 (PF00886.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0228 - Curated reference: UniProt P9WH53 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
240 functional partner(s); context anchor
rplQ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003091|Rv2909c|rpsP MAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKPSKLEVFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPALGGEQAELTAES