rplR Resolved · high auto-curated

H37Rv Rv0720 · MTBC0 mtbc0_000762 · 122 aa · 818133–818501 (+) · RefSeq NP_215234.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L18
MTBC0 PGAP re-annotation50S ribosomal protein L18
Revised (this work)50S ribosomal protein L18. Pfam: Ribosomal_L18p (PF00861.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHD1 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein uL18
Curated functionThis is one of the proteins that bind and probably mediate the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplR
eggNOG descriptionThis is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance
Orthologous groupCOG0256
KEGG orthology K02881
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (32) GO:0003674, GO:0003676, GO:0003723, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0008097, GO:0008150 +20 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.389 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L18pPF00861.28 7.5e-488–122 Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplF (50S ribosomal protein L6), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0634B rpmG2 50S ribosomal protein L33 999 1000 coexpression:724 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:753 experimental:999
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:736 experimental:999
Rv0651 rplJ 50S ribosomal protein L10 999 1000 coexpression:864 experimental:999 database:844
Rv0702 rplD 50S ribosomal protein L4 999 1000 coexpression:957 experimental:999 database:658
Rv3443c rplM 50S ribosomal protein L13 999 1000 coexpression:885 experimental:999 database:801
Rv0719 rplF 50S ribosomal protein L6 999 1000 ctx neighborhood:882 cooccurence:662 coexpression:988 experimental:999 database:844 textmining:565
Rv3456c rplQ 50S ribosomal protein L17 999 1000 coexpression:886 experimental:999 textmining:566
Rv0707 rpsC 30S ribosomal protein S3 999 1000 ctx cooccurence:540 coexpression:970 experimental:999
Rv2442c rplU 50S ribosomal protein L21 999 1000 coexpression:849 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:837 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 ctx neighborhood:855 coexpression:968 experimental:999 database:844 textmining:845
Rv0723 rplO 50S ribosomal protein L15 999 1000 ctx neighborhood:855 cooccurence:533 coexpression:958 experimental:999 database:825
Rv3459c rpsK 30S ribosomal protein S11 999 1000 ctx cooccurence:500 coexpression:865 experimental:999 textmining:480
Rv0706 rplV 50S ribosomal protein L22 999 1000 ctx cooccurence:598 coexpression:967 experimental:999 database:844

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L18
  • MTBC0 PGAP product: 50S ribosomal protein L18
  • Pfam (hmmscan --cut_ga): Ribosomal_L18p PF00861.28 (E=8e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215234.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L18p (PF00861.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0256
  • Curated reference: UniProt P9WHD1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 218 functional partner(s); context anchor rplF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000762|Rv0720|rplR
MAQSVSATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVAAASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGGRIAALADAARENGLSF