rplT Resolved · high auto-curated

H37Rv Rv1643 · MTBC0 mtbc0_001752 · 129 aa · 1865205–1865594 (+) · RefSeq NP_216159.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L20
MTBC0 PGAP re-annotation50S ribosomal protein L20
Revised (this work)50S ribosomal protein L20. Pfam: Ribosomal_L20 (PF00453.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHC5 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL20
Curated functionBinds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerplT
eggNOG descriptionBinds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit
Orthologous groupCOG0292
KEGG orthology K02887
KEGG pathways map03010
KEGG modules M00178
Gene Ontology (46) GO:0000027, GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005840, GO:0005886, GO:0006996 +34 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L20PF00453.24 1.7e-413–109 Ribosomal protein L20

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rplX (50S ribosomal protein L24), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0709 rpmC 50S ribosomal protein L29 999 1000 coexpression:815 experimental:999
Rv0721 rpsE 30S ribosomal protein S5 999 1000 coexpression:831 experimental:999 textmining:596
Rv0715 rplX 50S ribosomal protein L24 999 1000 ctx cooccurence:442 coexpression:795 experimental:999
Rv0710 rpsQ 30S ribosomal protein S17 999 1000 coexpression:840 experimental:999
Rv2412 rpsT 30S ribosomal protein S20 999 1000 coexpression:683 experimental:999 textmining:422
Rv3461c rpmJ 50S ribosomal protein L36 999 1000 coexpression:839 experimental:999
Rv0716 rplE 50S ribosomal protein L5 999 1000 coexpression:853 experimental:999 textmining:688
Rv2785c rpsO 30S ribosomal protein S15 999 1000 coexpression:855 experimental:999
Rv3460c rpsM 30S ribosomal protein S13 999 1000 coexpression:803 experimental:999 textmining:545
Rv0701 rplC 50S ribosomal protein L3 999 1000 coexpression:902 experimental:999 textmining:687
Rv2909c rpsP 30S ribosomal protein S16 999 1000 coexpression:862 experimental:999 textmining:733
Rv1642 rpmI 50S ribosomal protein L35 999 1000 ctx neighborhood:800 coexpression:976 experimental:999 textmining:760
Rv0714 rplN 50S ribosomal protein L14 999 1000 coexpression:856 experimental:999 textmining:593
Rv0683 rpsG 30S ribosomal protein S7 999 1000 coexpression:830 experimental:999 textmining:850
Rv0703 rplW 50S ribosomal protein L23 999 1000 coexpression:853 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 50S ribosomal protein L20
  • MTBC0 PGAP product: 50S ribosomal protein L20
  • Pfam (hmmscan --cut_ga): Ribosomal_L20 PF00453.24 (E=2e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216159.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L20 (PF00453.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0292
  • Curated reference: UniProt P9WHC5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 222 functional partner(s); context anchor rplX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001752|Rv1643|rplT
MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKLWIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPEDVNAPSGEAA