mftE Resolved · high auto-curated

H37Rv Rv0695 · MTBC0 mtbc0_000736 · 251 aa · 798801–799556 MTBC0 (+) · RefSeq NP_215209.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv0686 (Rv0686) — family_assigned: SHOCT domain-containing protein Rv0687 (Rv0687) — family_assigned: Rv0687 family mycofactocin-dependent SDR oxidoreductase Rv0687 Rv0688 (Rv0688) — requalified: FAD/NAD(P)-binding oxidoreductase Rv0688 Rv0690c (Rv0690c) — family_assigned: DUF2332 domain-containing protein Rv0690c mftR (Rv0691c) — family_assigned: mycofactocin system transcriptional regulator mftB (Rv0692) — requalified: mycofactocin biosynthesis chaperone MftB mftC (Rv0693) — requalified: mycofactocin radical SAM maturase mftC mftD (Rv0694) — requalified: pre-mycofactocin synthase MftD mftD mftE (Rv0695) — requalified: mycofactocin biosynthesis peptidyl-dipeptidase MftE mftF (Rv0696) — requalified: mycofactocin biosynthesis glycosyltransferase MftF mftF mftG (Rv0697) — family_assigned: mycofactocin system GMC family oxidoreductase MftG mftG Rv0699 (Rv0699) — dark: hypothetical protein rplC (Rv0701) — requalified: 50S ribosomal protein L3 rplD (Rv0702) — requalified: 50S ribosomal protein L4 rplW (Rv0703) — requalified: 50S ribosomal protein L23 rplB (Rv0704) — requalified: 50S ribosomal protein L2 rplB rpsS (Rv0705) — requalified: 30S ribosomal protein S19 rplV (Rv0706) — requalified: 50S ribosomal protein L22 rpsC (Rv0707) — requalified: 30S ribosomal protein S3 rpsC rplP (Rv0708) — requalified: 50S ribosomal protein L16 rpmC (Rv0709) — requalified: 50S ribosomal protein L29 rpsQ (Rv0710) — requalified: 30S ribosomal protein S17 atsA (Rv0711) — requalified: arylsulfatase AtsA 788 kb 792 kb 796 kb 800 kb 804 kb 808 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mycofactocin system creatinine amidohydrolase family protein MftE
MTBC0 PGAP re-annotationmycofactocin biosynthesis peptidyl-dipeptidase MftE
Revised (this work)Mycofactocin biosynthesis peptidyl-dipeptidase MftE. Pfam: Creatininase (PF02633.20).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) studied as much outside M. tuberculosis

The biology of this gene is documented at least as much outside M. tuberculosis as within it — 3 paper(s) in a non-TB mycobacterial context (M. marinum 1, M. smegmatis 3) versus 1 in a TB context. Mycobacterial genetics is largely done in M. smegmatis, so part of what is “known” about this gene is known by proxy.

Caveat: IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge.

4 TB publications mention this gene. 4 publication(s) discuss this gene. **Its biology is documented at least as much OUTSIDE M. tuberculosis as within it** (3 papers in a non-TB mycobacterial context — M. smegmatis (3), M. marinum (1) — vs 1 in a TB context). Mycobacterial genetics is largely done in M. smegmatis, so part of what is 'known' about this gene is known by proxy.

PublicationDate
MftD Catalyzes the Formation of a Biologically Active Redox Center in the Biosynthesis of the Ribosomally Synthesized and Post-translationally Modified Redox Cofactor Mycofactocin. doi:10.1021/jacs.9b06102 2019
Mycofactocin Is Associated with Ethanol Metabolism in Mycobacteria. doi:10.1128/mBio.00190-19 2019
Occurrence, function, and biosynthesis of mycofactocin. doi:10.1007/s00253-019-09684-4 2019
The Creatininase Homolog MftE from Mycobacterium smegmatis Catalyzes a Peptide Cleavage Reaction in the Biosynthesis of a Novel Ribosomally Synthesized Post-translationally Modified Peptide (RiPP). doi:10.1074/jbc.M116.762062 2017

IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Mycofactocin Synthesis Pathway.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index -0.08 (95% CI -2.89 to 2.80). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (curated function (UniProt), EC number, requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0714 · 99.6% identity
M. marinum MMAR_1023 · 78.5% identity
M. smegmatis MSMEG_1425 · 65.6% identity
M. orygis RJtmp_000733 · 99.6% identity
M. abscessus MAB_3832c · 59.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WP59 SwissProt · reviewed · Evidence at protein level
UniProt nameMycofactocin precursor peptide peptidase
EC (curated) EC 3.4.14.14
Curated functionPeptidase involved in the biosynthesis of the enzyme cofactor mycofactocin (MFT). Catalyzes cleavage of the MftC-modified MftA peptide to liberate its final two residues, which consist of a cross-linked valine-decarboxylated tyrosine dipeptide (named 3-amino-5-[(4-hydroxyphenyl)methyl]-4,4-dimethyl-2-pyrrolidin-2-one or ADHP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemftE
eggNOG descriptioncreatinine amidohydrolase family protein
Orthologous groupCOG1402
EC number EC 3.5.2.10
KEGG orthology K01470
KEGG pathways map00330

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.249 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 75.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 47.1%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) cholesterol-required

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 37.7272727273. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Cholesterol catabolismrequired for growth on cholesterol (Griffin 2011)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance23.8 ppm · rank 2224/3519 (36.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length251 aa
Molecular weight26.6 kDa
Theoretical pI7.12
GRAVY-0.08 (hydrophilic)
Aliphatic index84.0
Aromaticity0.044
Instability index54.1 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CreatininasePF02633.20 1.9e-6125–238 Creatinine amidohydrolase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.2

PDB hitprobTM-scoreE-valueDescription
3a6f-assembly1_D 1.00 0.69 2.2e-14 sig 3a6f-assembly1_D W174F mutant creatininase, Type II
3a6g-assembly1_C 1.00 0.70 5.9e-14 sig 3a6g-assembly1_C W154F mutant creatininase
3a6j-assembly1_E 1.00 0.70 6.2e-14 sig 3a6j-assembly1_E E122Q mutant creatininase complexed with creatine
3a6h-assembly1_F 1.00 0.69 5.2e-14 sig 3a6h-assembly1_F W154A mutant creatininase
3a6g-assembly1_B 1.00 0.70 1.7e-13 sig 3a6g-assembly1_B W154F mutant creatininase

Foldseek search of the AlphaFold DB model (mean pLDDT 93.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv0694 (+ strand, 189 bp gap)
Downstream (3' on genome)Rv0696 (+ strand, 48 bp gap)
Predicted operon Rv0695 · Rv0696 · Rv0697

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) Rv0081 (activates) · cmtR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mftF (mycofactocin biosynthesis glycosyltransferase MftF), high confidence from genomic context alone (score 991 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0696 mftF mycofactocin biosynthesis glycosyltransferase MftF 999 991 ctx neighborhood:813 cooccurence:695 coexpression:860 textmining:929
Rv0693 mftC exp mycofactocin radical SAM maturase MftC 995 970 ctx neighborhood:738 cooccurence:758 database:500 textmining:861
Rv0692 mftB exp mycofactocin system protein MftB 998 967 ctx neighborhood:738 cooccurence:757 database:500 textmining:943
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 988 879 ctx neighborhood:738 cooccurence:447 textmining:907
Rv0697 mftG dehydrogenase 845 845 ctx neighborhood:813
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 845 815 ctx cooccurence:707
Rv1639c hyp hypothetical protein 731 731 coexpression:731
Rv0690c hyp hypothetical protein 545 545 ctx neighborhood:529
Rv0691A mftA mycofactocin precursor 934 514 ctx neighborhood:514 textmining:870
Rv1990A Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g 465 466 ctx cooccurence:453
Rv1681 moeX molybdopterin biosynthesis protein MoeX 428 345
Rv0687 NAD-dependent oxidoreductase 634 297 textmining:501
Rv2750 dehydrogenase 629 281 textmining:505
Rv0761c adhB alcohol dehydrogenase B 737 237 textmining:670
Rv1872c lldD2 L-lactate dehydrogenase 537 151 textmining:477

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: mycofactocin system creatinine amidohydrolase family protein MftE
  • MTBC0 PGAP product: mycofactocin biosynthesis peptidyl-dipeptidase MftE
  • Pfam (hmmscan --cut_ga): Creatininase PF02633.20 (E=2e-61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215209.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Creatininase (PF02633.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1402
  • Curated reference: UniProt P9WP59 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor mftF
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000736|Rv0695|mftE
MNSSYHRRVPVVGELGSATSSQLPSTSPSIVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGEHQRFAGTISIGTEALTMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGRDAGWCPCTCPGGDPHAGHTETSVLLHLSPADVRTERWRAGNRAPLPVLLPSMRRGGVAAVSETGVLGDPTTATAAEGRRIFAAMVDDCVRRVARWMPQPDGMLT