mftE Resolved · high auto-curated

H37Rv Rv0695 · MTBC0 mtbc0_000736 · 251 aa · 798801–799556 (+) · RefSeq NP_215209.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mycofactocin system creatinine amidohydrolase family protein MftE
MTBC0 PGAP re-annotationmycofactocin biosynthesis peptidyl-dipeptidase MftE
Revised (this work)Mycofactocin biosynthesis peptidyl-dipeptidase MftE. Pfam: Creatininase (PF02633.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP59 SwissProt · reviewed · Evidence at protein level
UniProt nameMycofactocin precursor peptide peptidase
EC (curated) EC 3.4.14.14
Curated functionPeptidase involved in the biosynthesis of the enzyme cofactor mycofactocin (MFT). Catalyzes cleavage of the MftC-modified MftA peptide to liberate its final two residues, which consist of a cross-linked valine-decarboxylated tyrosine dipeptide (named 3-amino-5-[(4-hydroxyphenyl)methyl]-4,4-dimethyl-2-pyrrolidin-2-one or ADHP).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namemftE
eggNOG descriptioncreatinine amidohydrolase family protein
Orthologous groupCOG1402
EC number EC 3.5.2.10
KEGG orthology K01470
KEGG pathways map00330

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.249 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CreatininasePF02633.20 1.9e-6125–238 Creatinine amidohydrolase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mftF (mycofactocin biosynthesis glycosyltransferase MftF), high confidence from genomic context alone (score 991 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0696 mftF mycofactocin biosynthesis glycosyltransferase MftF 999 991 ctx neighborhood:813 cooccurence:695 coexpression:860 textmining:929
Rv0693 mftC mycofactocin radical SAM maturase MftC 995 970 ctx neighborhood:738 cooccurence:758 database:500 textmining:861
Rv0692 mftB mycofactocin system protein MftB 998 967 ctx neighborhood:738 cooccurence:757 database:500 textmining:943
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 988 879 ctx neighborhood:738 cooccurence:447 textmining:907
Rv0697 mftG dehydrogenase 845 845 ctx neighborhood:813
Rv0691c mftR mycofactocin biosynthesis transcriptional regulator MftR 845 815 ctx cooccurence:707
Rv1639c hyp hypothetical protein 731 731 coexpression:731
Rv0690c hyp hypothetical protein 545 545 ctx neighborhood:529
Rv0691A mftA mycofactocin precursor 934 514 ctx neighborhood:514 textmining:870
Rv1990A Rv1990A, len: 111 aa. Possible dehydrogenase (fragment), similar to N-terminal part of several dehydrogenases and hypothetical proteins, e.g 465 466 ctx cooccurence:453
Rv1681 moeX molybdopterin biosynthesis protein MoeX 428 345
Rv0687 NAD-dependent oxidoreductase 634 297 textmining:501
Rv2750 dehydrogenase 629 281 textmining:505
Rv0761c adhB alcohol dehydrogenase B 737 237 textmining:670
Rv1872c lldD2 L-lactate dehydrogenase 537 151 textmining:477

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: mycofactocin system creatinine amidohydrolase family protein MftE
  • MTBC0 PGAP product: mycofactocin biosynthesis peptidyl-dipeptidase MftE
  • Pfam (hmmscan --cut_ga): Creatininase PF02633.20 (E=2e-61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215209.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Creatininase (PF02633.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1402
  • Curated reference: UniProt P9WP59 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor mftF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000736|Rv0695|mftE
MNSSYHRRVPVVGELGSATSSQLPSTSPSIVIPLGSTEQHGPHLPLDTDTRIATAVARTVTARLHAEDLPIAQEEWLMAPAIAYGASGEHQRFAGTISIGTEALTMLLVEYGRSAACWARRLVFVNGHGGNVGALTRAVGLLRAEGRDAGWCPCTCPGGDPHAGHTETSVLLHLSPADVRTERWRAGNRAPLPVLLPSMRRGGVAAVSETGVLGDPTTATAAEGRRIFAAMVDDCVRRVARWMPQPDGMLT