rpmG2 Resolved · high auto-curated

H37Rv Rv0634B · MTBC0 - · 55 aa · 731712–731879 H37Rv (+) · RefSeq YP_177630.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L33
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L33. Pfam: Ribosomal_L33 (PF00471.27).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (0 in a M. tuberculosis context).

PublicationDate
The zinc-responsive regulator Zur controls a zinc uptake system and some ribosomal proteins in Streptomyces coelicolor A3(2). doi:10.1128/JB.01851-06 2007

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -6.85 (95% CI -7.52 to -6.19). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in translation mechanism

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0653 · 100.0% identity
M. leprae ML1911c · 92.7% identity
M. marinum MMAR_0967 · 96.4% identity
M. smegmatis MSMEG_1339 · 90.9% identity
M. orygis RJtmp_000669 · 100.0% identity
M. abscessus MAB_3899c · 89.1% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WH95 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL33B

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmG
eggNOG descriptionBelongs to the bacterial ribosomal protein bL33 family
Orthologous groupCOG0267
KEGG orthology K02913
KEGG pathways map03010
KEGG modules M00178

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.279 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 97.7% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 71.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) GD — not strictly essential

DeJesus 2017 callGD · growth-defect
What the call meansgrowth-defect: insertions tolerated but fitness reduced; NOT essential
TA sites (Himar1) 4 in the ORF — 0 in the essential state, 4 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.250, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Caveat`essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. Statistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance705.0 ppm · rank 311/3519 (91.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length55 aa
Molecular weight6.5 kDa
Theoretical pI9.87
GRAVY-1.253 (hydrophilic)
Aliphatic index51.5
Aromaticity0.036
Instability index36.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L33PF00471.27 1.0e-2310–55 Ribosomal protein L33

Experimental structures (Protein Data Bank) 10 solved

PDBMethodResolutionCoverage
7sfr Electron Microscopy 2.6 Å 100%
7kgb Electron Microscopy 2.7 Å 100%
7mt7 Electron Microscopy 2.71 Å 100%
7mt2 Electron Microscopy 2.76 Å 100%
7msm Electron Microscopy 2.79 Å 100%
7mt3 Electron Microscopy 2.8 Å 100%
7msc Electron Microscopy 2.97 Å 100%
7msz Electron Microscopy 3.1 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (10 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 84.9

PDB hitprobTM-scoreE-valueDescription
7y41-assembly1_c 1.00 0.98 3.3e-07 sig 7y41-assembly1_c Mycobacterium smegmatis 50S ribosomal subunit from Log Phase of growth
7msh-assembly1_1 1.00 0.97 1.2e-06 sig 7msh-assembly1_1 Mtb 70SIC in complex with MtbEttA at Pre_R1 state
8wi7-assembly1_6 1.00 0.96 8.1e-07 sig 8wi7-assembly1_6 Cryo- EM structure of Mycobacterium smegmatis 70S ribosome, bS1 and RafH.
8cvm-assembly1_0 1.00 0.97 1.9e-06 sig 8cvm-assembly1_0 Cutibacterium acnes 50S ribosomal subunit with P-site tRNA and Sarecycline bound in the local refined map
5v93-assembly1_1 1.00 0.94 1.1e-06 sig 5v93-assembly1_1 Cryo-EM structure of the 70S ribosome from Mycobacterium tuberculosis bound with Capreomycin

Foldseek search of the AlphaFold DB model (mean pLDDT 84.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 6

Upstream (5' on genome)metT (+ strand, 35 bp gap)
Downstream (3' on genome)hadA (+ strand, 50 bp gap)
Predicted operon thrT · metT · rpmG2 · hadA · hadB · hadC

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3459c rpsK exp 30S ribosomal protein S11 999 1000 coexpression:729 experimental:999
Rv0706 rplV exp 50S ribosomal protein L22 999 1000 coexpression:720 experimental:999
Rv0700 rpsJ exp 30S ribosomal protein S10 999 1000 coexpression:734 experimental:999
Rv0723 rplO exp 50S ribosomal protein L15 999 1000 coexpression:719 experimental:999
Rv1643 rplT exp 50S ribosomal protein L20 999 1000 coexpression:724 experimental:999
Rv0717 rpsN1 exp 30S ribosomal protein S14 999 1000 coexpression:653 experimental:999 textmining:594
Rv0682 rpsL exp 30S ribosomal protein S12 999 1000 coexpression:683 experimental:999
Rv3442c rpsI exp 30S ribosomal protein S9 999 1000 coexpression:727 experimental:999
Rv1298 rpmE exp 50S ribosomal protein L31 999 1000 coexpression:687 experimental:999 textmining:590
Rv2441c rpmA exp 50S ribosomal protein L27 999 1000 coexpression:731 experimental:999
Rv0720 rplR exp 50S ribosomal protein L18 999 1000 coexpression:724 experimental:999
Rv1015c rplY exp 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:650 experimental:999
Rv0056 rplI exp 50S ribosomal protein L9 999 1000 coexpression:714 experimental:999
Rv0722 rpmD exp 50S ribosomal protein L30 999 1000 coexpression:726 experimental:999
Rv0707 rpsC exp 30S ribosomal protein S3 999 1000 coexpression:727 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L33
  • Pfam (hmmscan --cut_ga): Ribosomal_L33 PF00471.27 (E=1e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177630.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L33 (PF00471.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0267
  • Curated reference: UniProt P9WH95 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 84.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 194 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0634B|rpmG2
MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR