rpmG2 Resolved · high auto-curated

H37Rv Rv0634B · MTBC0 - · 55 aa · 731712–731879 (+) · RefSeq YP_177630.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)50S ribosomal protein L33
MTBC0 PGAP re-annotation
Revised (this work)50S ribosomal protein L33. Pfam: Ribosomal_L33 (PF00471.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WH95 SwissProt · reviewed · Evidence at protein level
UniProt nameLarge ribosomal subunit protein bL33B

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpmG
eggNOG descriptionBelongs to the bacterial ribosomal protein bL33 family
Orthologous groupCOG0267
KEGG orthology K02913
KEGG pathways map03010
KEGG modules M00178

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.279 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_L33PF00471.27 1.0e-2310–55 Ribosomal protein L33

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3459c rpsK 30S ribosomal protein S11 999 1000 coexpression:729 experimental:999
Rv0706 rplV 50S ribosomal protein L22 999 1000 coexpression:720 experimental:999
Rv0700 rpsJ 30S ribosomal protein S10 999 1000 coexpression:734 experimental:999
Rv0723 rplO 50S ribosomal protein L15 999 1000 coexpression:719 experimental:999
Rv1643 rplT 50S ribosomal protein L20 999 1000 coexpression:724 experimental:999
Rv0717 rpsN1 30S ribosomal protein S14 999 1000 coexpression:653 experimental:999 textmining:594
Rv0682 rpsL 30S ribosomal protein S12 999 1000 coexpression:683 experimental:999
Rv3442c rpsI 30S ribosomal protein S9 999 1000 coexpression:727 experimental:999
Rv1298 rpmE 50S ribosomal protein L31 999 1000 coexpression:687 experimental:999 textmining:590
Rv2441c rpmA 50S ribosomal protein L27 999 1000 coexpression:731 experimental:999
Rv0720 rplR 50S ribosomal protein L18 999 1000 coexpression:724 experimental:999
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 999 1000 coexpression:650 experimental:999
Rv0056 rplI 50S ribosomal protein L9 999 1000 coexpression:714 experimental:999
Rv0722 rpmD 50S ribosomal protein L30 999 1000 coexpression:726 experimental:999
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:727 experimental:999

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 50S ribosomal protein L33
  • Pfam (hmmscan --cut_ga): Ribosomal_L33 PF00471.27 (E=1e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177630.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_L33 (PF00471.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0267
  • Curated reference: UniProt P9WH95 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 194 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0634B|rpmG2
MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR