rpsN2 Resolved · high auto-curated

H37Rv Rv2056c · MTBC0 mtbc0_002189 · 101 aa · 2342967–2343272 (-) · RefSeq NP_216572.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)30S ribosomal protein S14
MTBC0 PGAP re-annotation30S ribosomal protein S14
Revised (this work)30S ribosomal protein S14. Pfam: Ribosomal_S14 (PF00253.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH59 SwissProt · reviewed · Inferred from homology
UniProt nameSmall ribosomal subunit protein uS14A
Curated functionBinds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerpsN
eggNOG descriptionBinds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site
Orthologous groupCOG0199
KEGG orthology K02954
KEGG pathways map03010
KEGG modules M00178, M00179
Gene Ontology (50) GO:0003674, GO:0003735, GO:0005198, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005840, GO:0006412, GO:0006518, GO:0006807 +38 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.74 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Ribosomal_S14PF00253.28 2.3e-2348–100 Ribosomal protein S14p/S29e

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpmB2 (50S ribosomal protein L28), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0700 rpsJ 30S ribosomal protein S10 999 1000 coexpression:732 experimental:997 database:662
Rv3442c rpsI 30S ribosomal protein S9 999 1000 coexpression:716 experimental:997 database:662
Rv0707 rpsC 30S ribosomal protein S3 999 1000 coexpression:733 experimental:997 database:662
Rv0705 rpsS 30S ribosomal protein S19 999 1000 coexpression:732 experimental:997 database:662
Rv2058c rpmB2 50S ribosomal protein L28 999 999 ctx neighborhood:882 coexpression:927 experimental:789 textmining:575
Rv2055c rpsR2 30S ribosomal protein S18 999 998 ctx neighborhood:882 coexpression:908 experimental:870 textmining:781
Rv2057c rpmG1 50S ribosomal protein L33 999 997 ctx neighborhood:882 coexpression:771 experimental:870 textmining:831
Rv2909c rpsP 30S ribosomal protein S16 990 989 coexpression:726 experimental:870 database:662
Rv3459c rpsK 30S ribosomal protein S11 991 988 coexpression:731 experimental:870 database:662
Rv0682 rpsL 30S ribosomal protein S12 989 988 coexpression:731 experimental:870 database:662
Rv0702 rplD 50S ribosomal protein L4 989 988 coexpression:733 experimental:870 database:662
Rv0718 rpsH 30S ribosomal protein S8 989 988 coexpression:733 experimental:870 database:662
Rv2890c rpsB 30S ribosomal protein S2 989 988 coexpression:733 experimental:870 database:662
Rv3458c rpsD 30S ribosomal protein S4 989 988 coexpression:732 experimental:870 database:662
Rv0683 rpsG 30S ribosomal protein S7 989 988 coexpression:732 experimental:870 database:662

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 30S ribosomal protein S14
  • MTBC0 PGAP product: 30S ribosomal protein S14
  • Pfam (hmmscan --cut_ga): Ribosomal_S14 PF00253.28 (E=2e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216572.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Ribosomal_S14 (PF00253.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0199
  • Curated reference: UniProt P9WH59 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 183 functional partner(s); context anchor rpmB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002189|Rv2056c|rpsN2
MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSSAPEQRSTAQRALARQPRDASPVRLRNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW