Rv2721c Family assigned · medium auto-curated

H37Rv Rv2721c · MTBC0 mtbc0_002895 · 699 aa · 3054935–3057034 (-) · RefSeq NP_217237.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationLGFP repeat-containing protein
Revised (this work)LGFP repeat-containing protein. Pfam: LGFP (PF08310.18), ArfC (PF27542.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XF52 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved transmembrane alanine and glycine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionprotein potentially involved in peptidoglycan biosynthesis
Orthologous groupCOG5479

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.55 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 13 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LGFPPF08310.18 2.7e-11240–289 LGFP repeat
ArfCPF27542.1 7.1e-11642–696 ArfC

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pirG (cell surface protein), high confidence from genomic context alone (score 918 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3810 pirG cell surface protein 918 918 ctx cooccurence:709 coexpression:730
Rv0312 hyp hypothetical protein 851 850 coexpression:827
Rv1477 ripA peptidoglycan endopeptidase RipA 837 831 coexpression:804
Rv0040c mtc28 hyp hypothetical protein 803 803 coexpression:803
Rv1157c hyp hypothetical protein 798 799 coexpression:730
Rv1478 ripB peptidoglycan endopeptidase RipB 803 796 coexpression:796
Rv3414c sigD ECF RNA polymerase sigma factor SigD 785 785 coexpression:785
Rv2145c wag31 cell wall synthesis protein Wag31 751 751 coexpression:751
Rv0479c membrane protein 745 746 ctx cooccurence:742
Rv1566c ripD hyp hypothetical protein 747 738 coexpression:738
Rv2015c hyp hypothetical protein 728 729 ctx cooccurence:727
Rv1765c hyp hypothetical protein 704 705 ctx cooccurence:703
Rv0941c hyp hypothetical protein 686 686 ctx cooccurence:685
Rv0320 hyp hypothetical protein 681 681 ctx cooccurence:677
Rv0441c hyp hypothetical protein 679 680 ctx cooccurence:679

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: LGFP repeat-containing protein
  • Pfam (hmmscan --cut_ga): LGFP PF08310.18 (E=3e-11), ArfC PF27542.1 (E=7e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217237.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LGFP (PF08310.18), ArfC (PF27542.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5479
  • Curated reference: UniProt I6XF52 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 88 functional partner(s); context anchor pirG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002895|Rv2721c|
MNGQRGQLSTLIGRTLLGLAATAVTAVLLAPTVAASPMGDAEDAMMAAWEKAGGDTSTLGVRKGDVYPIGDGFALDFAGGKMFFTPATGAKYLYGPLLDKYESLGGAADSDLGFPTINEVPGLAGPDSRVSTFSAADNPVIFWTPEHGAFVVRGALNAAWDKLGSSGGVLGAPVGDETYDGEVTAQKFSGGEVSWNRATKEFTTVPAVLAEQLKGLQVAIDPSAAINMAWRAAGGAAGPLGAKKGGQYPIGGDGIAQDFVGGKVFFSPATGANAVEGEILAKYESLGGPVSSDLGFPIANETDGGFGPSSRIVRFSAADKPVIFWTPDHGAFVVRGAMVAAWDKLRGPNGKLGAPVGDQTVDGDVVSQKFTGGMISWNRAKNTFTTDPANLAPLLSGLQVSGQNQPSTSAMPPPGKKFTWHWWWLGAAALGVLLVVMVALVVFGLRRRRRGYDAAAYDDDRAGDVEYGTAADGDWPPDEDFGSEHFGFGDQFPPEPVAPDAGSTPRVSWPRGAGAAVGDAEHLPGEEGYGSDLLSGPSNVGVEEEDTDAVDTTPTPVVSQADLSEVGPDLIVPERVVPETFVPQAFVPEAVAPEAVPPDVHAADLADTGLPAAAVSAAEDRGGRHAAAEPPEPPSAGVRPAIHLPLEDPYQMPNGYPVKASVSFGLYYPPGSALYHDTLAELWFASEEVAQVNGFIRAD