Rv2717c Family assigned · medium auto-curated
H37Rv Rv2717c · MTBC0 mtbc0_002891 ·
164 aa · 3052282–3052776 (-) ·
RefSeq NP_217233.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | FABP family protein |
| Revised (this work) | FABP family protein. Pfam: THAP4_heme-bd (PF08768.18). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WFG7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Peroxynitrite isomerase 1 |
| EC (curated) |
EC 5.99.-.-
|
| Curated function | Heme-binding protein able to scavenge peroxynitrite and to protect free L-tyrosine against peroxynitrite-mediated nitration, by acting as a peroxynitrite isomerase that converts peroxynitrite to nitrate. Therefore, this protein likely plays a role in peroxynitrite sensing and in the detoxification of reactive nitrogen and oxygen species (RNS and ROS, respectively). In M.tuberculosis, could be part of the pool of proteins required to scavenge RNS and ROS produced by the host during the immunity response. Is able to bind nitric oxide (NO) in vitro, but may act as a sensor of peroxynitrite levels. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | May play a role in the intracellular transport of hydrophobic ligands |
| Orthologous group | COG4044 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.351 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.80% of strains (1162) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
THAP4_heme-bd | PF08768.18 | 4.2e-49 | 9–162 | THAP4-like, heme-binding beta-barrel domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: nrdR (transcriptional regulator NrdR), high confidence from genomic context alone (score 724 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2718c nrdR |
transcriptional regulator NrdR | 724 | 724 ctx | neighborhood:720 |
Rv1158c hyp |
hypothetical protein | 604 | 604 ctx | cooccurence:604 |
Rv2719c chiZ |
membrane protein | 606 | 564 ctx | neighborhood:549 |
Rv1010 ksgA |
rRNA small subunit methyltransferase A | 550 | 509 | coexpression:492 |
Rv1988 erm(37) |
23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | 547 | 506 | coexpression:489 |
Rv2126c PE_PGRS37 |
PE-PGRS family protein PE_PGRS37 | 506 | 506 ctx | cooccurence:506 |
Rv2720 lexA |
repressor LexA | 461 | 461 ctx | neighborhood:454 |
Rv0819 mshD |
mycothiol acetyltransferase | 446 | 446 | |
Rv3829c |
dehydrogenase | 435 | 435 | |
Rv3775 lipE |
lipase LipE | 403 | 403 ctx | neighborhood:403 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: FABP family protein
- Pfam (hmmscan --cut_ga): THAP4_heme-bd PF08768.18 (E=4e-49)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217233.1)
- Domains: Pfam-A via hmmscan --cut_ga — THAP4_heme-bd (PF08768.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4044 - Curated reference: UniProt P9WFG7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
nrdR - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002891|Rv2717c| MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR