miaA Resolved · high auto-curated

H37Rv Rv2727c · MTBC0 mtbc0_002901 · 314 aa · 3062240–3063184 (-) · RefSeq NP_217243.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tRNA delta(2)-isopentenylpyrophosphate transferase
MTBC0 PGAP re-annotationtRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA
Revised (this work)TRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA. Pfam: IPPT (PF01715.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJW1 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA dimethylallyltransferase
EC (curated) EC 2.5.1.75
Curated functionCatalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namemiaA
eggNOG descriptionCatalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A)
Orthologous groupCOG0324
EC number EC 2.5.1.75
KEGG orthology K00791
KEGG pathways map00908, map01100, map01110
Gene Ontology (32) GO:0003674, GO:0003824, GO:0006139, GO:0006396, GO:0006399, GO:0006400, GO:0006725, GO:0006807, GO:0008033, GO:0008150, GO:0008152, GO:0009451 +20 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.003 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
IPPTPF01715.24 6.9e-7940–283 IPP transferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hflX (GTP-binding protein HflX), high confidence from genomic context alone (score 875 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2728c hyp hypothetical protein 889 889 ctx neighborhood:882
Rv2725c hflX GTP-binding protein HflX 904 875 ctx neighborhood:733 coexpression:551
Rv2726c dapF diaminopimelate epimerase 850 850 ctx neighborhood:849
Rv2733c miaB (dimethylallyl)adenosine tRNA methylthiotransferase 939 812 ctx fusion:725 textmining:691
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 829 666 ctx cooccurence:530 textmining:511
Rv2165c rsmH rRNA small subunit methyltransferase H 656 612 coexpression:417
Rv2729c integral membrane protein 604 588 ctx neighborhood:558
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 579 579 coexpression:421
Rv2731 hyp hypothetical protein 568 568 ctx neighborhood:506
Rv2343c dnaG DNA primase 611 555 coexpression:405
Rv3610c ftsH zinc metalloprotease FtsH 598 545 coexpression:423
Rv2554c ruvX Holliday junction resolvase 545 545 coexpression:508
Rv3433c nnr bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase 635 499
Rv2724c fadE20 acyl-CoA dehydrogenase FadE20 489 489 ctx neighborhood:489
Rv3418c groES chaperonin GroES 487 488

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tRNA delta(2)-isopentenylpyrophosphate transferase
  • MTBC0 PGAP product: tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA
  • Pfam (hmmscan --cut_ga): IPPT PF01715.24 (E=7e-79)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217243.1)
  • Domains: Pfam-A via hmmscan --cut_ga — IPPT (PF01715.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0324
  • Curated reference: UniProt P9WJW1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor hflX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002901|Rv2727c|miaA
MRPLAIIGPTGAGKSQLALDVAARLGARVSVEIVNADAMQLYRGMDIGTAKLPVSERRGIPHHQLDVLDVTETATVARYQRAAAADIEAIAARGAVPVVVGGSMLYVQSLLDDWSFPATDPSVRARWERRLAEVGVDRLHAELARRDPAAAAAILPTDARRTVRALEVVELTGQPFAASAPRIGAPRWDTVIVGLDCQTTILDERLARRTDLMFDQGLVEEVRTLLRNGLREGVTASRALGYAQVIAALDAGAGADMMRAAREQTYLGTRRYVRRQRSWFRRDHRVHWLDAGVASSPDRARLVDDAVRLWRHVT