Rv0320 Family assigned · medium auto-curated

H37Rv Rv0320 · MTBC0 mtbc0_000341 · 220 aa · 391211–391873 (+) · RefSeq NP_214834.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains VldE (PF26571.1) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07246 TrEMBL · unreviewed · Predicted
UniProt namePossible conserved exported protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionsh3 domain protein
Orthologous groupCOG3103

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.359 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VldEPF26571.1 3.2e-20103–192 VldE, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pcp (pyrrolidone-carboxylate peptidase), high confidence from genomic context alone (score 756 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0319 pcp pyrrolidone-carboxylate peptidase 757 756 ctx neighborhood:754
Rv0321 dcd deoxycytidine triphosphate deaminase 702 703 ctx neighborhood:700
Rv2862c hyp hypothetical protein 686 687 ctx cooccurence:673
Rv2721c hyp hypothetical protein 681 681 ctx cooccurence:677
Rv3810 pirG cell surface protein 675 675 ctx cooccurence:670
Rv3707c hyp hypothetical protein 662 663 ctx cooccurence:661
Rv0479c membrane protein 651 651 ctx cooccurence:651
Rv3593 lpqF lipoprotein LpqF 604 604 ctx cooccurence:603
Rv2743c hyp hypothetical protein 582 582 ctx cooccurence:582
Rv2712c hyp hypothetical protein 576 577 ctx cooccurence:574
Rv2015c hyp hypothetical protein 550 550 ctx cooccurence:549
Rv0322 udgA UDP-glucose 6-dehydrogenase UdgA 514 515 ctx neighborhood:513
Rv2151c ftsQ cell division protein FtsQ 517 513 ctx cooccurence:510
Rv0318c integral membrane protein 502 502 ctx neighborhood:496
Rv3803c fbpD MPT51/MPB51 antigen 502 502 ctx cooccurence:500

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): VldE PF26571.1 (E=3e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214834.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VldE (PF26571.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3103
  • Curated reference: UniProt O07246 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor pcp
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000341|Rv0320|
MGRHELARDRRKSSAVLAAVLAPAAVFFATGGDVSTLAARADANPVLGDDAPCCVQIVPVAPLAFSSQISGGEIGTGLAASQFASASRWRIVSRYLPVGVAPEQGLQVKTVLTARSISAAFPEIREIGGVRPDALRWHPNGLALDVMVPNPGTAEGIALGNEIVAFVLKNATRFGMQDVIWRGAYYTPNGARTTGAGHYDHIHITTVGGGYPTGEELYIR