nrdR Family assigned · medium auto-curated

H37Rv Rv2718c · MTBC0 mtbc0_002892 · 154 aa · 3052828–3053292 (-) · RefSeq NP_217234.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator NrdR
MTBC0 PGAP re-annotationtranscriptional regulator NrdR
Revised (this work)Transcriptional regulator NrdR. Pfam: Zn_ribbon_NrdR (PF22811.3), ATP-cone (PF03477.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIZ1 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional repressor NrdR
Curated functionNegatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR-boxes.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namenrdR
eggNOG descriptionNegatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR- boxes
Orthologous groupCOG1327
KEGG orthology K07738
Gene Ontology (8) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.344 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Zn_ribbon_NrdRPF22811.3 5.5e-211–42 Transcriptional repressor NrdR-like, N-terminal domain
ATP-conePF03477.22 3.3e-1847–132 ATP cone domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lexA (repressor LexA), high confidence from genomic context alone (score 770 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2720 lexA repressor LexA 799 770 ctx neighborhood:667
Rv2719c chiZ membrane protein 760 761 ctx neighborhood:747
Rv2717c hyp hypothetical protein 724 724 ctx neighborhood:720
Rv1409 ribG bifunctional riboflavin biosynthesis diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino) uracil reductas 746 517 textmining:496
Rv0422c thiD hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 419 420 coexpression:419
Rv1901 cinA competence damage-inducible protein CinA 414 414
Rv1629 polA DNA polymerase I 448 275
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 437 205
Rv1940 ribA1 riboflavin biosynthesis protein RibA 436 203
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 507 177 textmining:426
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 415 146
Rv3053c nrdH glutaredoxin electron transport protein NrdH 665 125 textmining:633
Rv3242c hyp hypothetical protein 701 106 textmining:680
Rv1314c cob(I)yrinic acid a,c-diamide adenosyltransferase 440 99 textmining:405
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 408 94

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator NrdR
  • MTBC0 PGAP product: transcriptional regulator NrdR
  • Pfam (hmmscan --cut_ga): Zn_ribbon_NrdR PF22811.3 (E=5e-21), ATP-cone PF03477.22 (E=3e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217234.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Zn_ribbon_NrdR (PF22811.3), ATP-cone (PF03477.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1327
  • Curated reference: UniProt P9WIZ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor lexA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002892|Rv2718c|nrdR
MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVKRSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAGSPEIPSHDVGLAILGPLRELDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS