lexA Resolved · high auto-curated

H37Rv Rv2720 · MTBC0 mtbc0_002894 · 236 aa · 3054203–3054913 (+) · RefSeq NP_217236.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)repressor LexA
MTBC0 PGAP re-annotationtranscriptional repressor LexA
Revised (this work)Transcriptional repressor LexA. Pfam: LexA_DNA_bind (PF01726.23), Peptidase_S24 (PF00717.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHR7 SwissProt · reviewed · Evidence at protein level
UniProt nameLexA repressor
EC (curated) EC 3.4.21.88
Curated functionRepresses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Has been shown to bind to the 14 bp palindromic sequence 5'-CGAACNNNNGTTCG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namelexA
eggNOG descriptionRepresses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair
Orthologous groupCOG1974
EC number EC 3.4.21.88
KEGG orthology K01356
KEGG modules M00729
Gene Ontology (67) GO:0000976, GO:0001067, GO:0001130, GO:0001217, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0005575, GO:0005618 +55 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.12 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LexA_DNA_bindPF01726.23 1.4e-2925–88 LexA DNA binding domain
Peptidase_S24PF00717.29 3.6e-33118–230 Peptidase S24-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: chiZ (membrane protein), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2737c recA recombinase A 998 977 coexpression:855 experimental:829 textmining:958
Rv2719c chiZ membrane protein 859 773 ctx neighborhood:723 textmining:408
Rv2718c nrdR transcriptional regulator NrdR 799 770 ctx neighborhood:667
Rv1537 dinX DNA polymerase IV 925 681 experimental:463 textmining:777
Rv1696 recN DNA repair protein RecN 869 651 coexpression:649 textmining:640
Rv3056 dinP DNA polymerase IV 2 832 601 experimental:463 textmining:598
Rv3394c hyp hypothetical protein 629 589 experimental:463
Rv2717c hyp hypothetical protein 461 461 ctx neighborhood:454
Rv1931c transcriptional regulator 454 451
Rv0052 hyp hypothetical protein 452 450
Rv1930c hyp hypothetical protein 471 448
Rv2191 hyp hypothetical protein 646 422 textmining:413
Rv3833 AraC family transcriptional regulator 408 409
Rv1657 argR arginine repressor 835 381 textmining:745
Rv0605 IS1536 family serine type transposase 445 380

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: repressor LexA
  • MTBC0 PGAP product: transcriptional repressor LexA
  • Pfam (hmmscan --cut_ga): LexA_DNA_bind PF01726.23 (E=1e-29), Peptidase_S24 PF00717.29 (E=4e-33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217236.2)
  • Domains: Pfam-A via hmmscan --cut_ga — LexA_DNA_bind (PF01726.23), Peptidase_S24 (PF00717.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1974
  • Curated reference: UniProt P9WHR7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 85 functional partner(s); context anchor chiZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002894|Rv2720|lexA
MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV